Result : Q7NMH4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 843983 |
| Right | 844168 |
| Strand | - |
| Nucleotide Sequence | ATGGCTCAGCCAAAGAAAAAGACCTCCAACGCCAAGCGGGATCAGCGCCGCGCCACCTGGAAGCGCAAAGCGCGTGTGCAGGCTGAAAAAGCCCTTGCCCTCGGCAAGTCGATCCTCTCGGGCAACAACACGGGTTTCTACTACCCGCAGCTCGAAGCAGAGGAAGAAGAGCAAGCAGAAGAGTAG |
| Sequence | MAQPKKKTSNAKRDQRRATWKRKARVQAEKALALGKSILSGNNTGFYYPQLEAEEEEQAEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 14621292 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7NMH4 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 843983 | 844168 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 792795 | 792980 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 3147446 | 3147619 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 4 | 1327697 | 1327876 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 5 | 6860891 | 6861070 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 6 | 2008104 | 2008271 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 7 | 5875863 | 5876036 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 8 | 2133450 | 2133623 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 9 | 4288085 | 4288267 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 10 | 2759789 | 2759965 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 11 | 4484740 | 4484913 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 12 | 983771 | 983944 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 13 | 5820313 | 5820486 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 14 | 2852058 | 2852237 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 15 | 1091350 | 1091526 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 16 | 900624 | 900797 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 17 | 2189659 | 2189835 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 18 | 742160 | 742342 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 19 | 5887636 | 5887809 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 20 | 2970985 | 2971164 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 21 | 2453573 | 2453740 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 22 | 3060120 | 3060296 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 23 | 1991295 | 1991474 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 24 | 5130540 | 5130713 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 25 | 2186852 | 2187025 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 26 | 3404048 | 3404221 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 27 | 1219448 | 1219627 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 28 | 1883793 | 1883975 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 29 | 2005312 | 2005494 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 30 | 3716085 | 3716258 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 31 | 1287690 | 1287866 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
++ More..