Result : Q7NMA9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome b559 subunit beta (PSII reaction center subunit VI) |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 905972 |
| Right | 906127 |
| Strand | + |
| Nucleotide Sequence | ATGACCACTTCTTCGAACCGTCCCACCCCCGGTGGCCCGACCCAGCCCGTCTCCTACCCGGTCTTCACCGTCCGCTGGCTGGCGGTCCACGCCCTGACCGTGCCCACGATCTTCTTCCTGGGCGCTCTGGCCGCGATGCAGTTTATCCAGCGCTAA |
| Sequence | MTTSSNRPTPGGPTQPVSYPVFTVRWLAVHALTVPTIFFLGALAAMQFIQR |
| Source of smORF | Swiss-Prot |
| Function | This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_00643}. |
| Pubmed ID | 14621292 |
| Domain | CDD:395220,CDD:355706 |
| Functional Category | Metal-binding |
| Uniprot ID | Q7NMA9 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 905972 | 906127 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 3372539 | 3372691 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 3012243 | 3012377 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 4 | 856091 | 856225 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 5 | 4984061 | 4984195 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 6 | 3000093 | 3000227 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 7 | 978326 | 978463 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 8 | 3491726 | 3491860 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 9 | 3375401 | 3375535 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 10 | 2035759 | 2035893 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 11 | 1354110 | 1354247 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 12 | 1488126 | 1488263 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 13 | 1610579 | 1610716 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 14 | 5254112 | 5254246 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 15 | 1432273 | 1432407 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 16 | 969751 | 969888 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 17 | 318840 | 318986 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005125.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00301.22 | 0.76 | 13 | 1475 | same-strand | Rubredoxin |
| 2 | PF14870.8 | 0.76 | 13 | 362 | same-strand | Photosynthesis system II assembly factor YCF48 |
| 3 | PF00284.22 | 1.0 | 17 | 25 | same-strand | Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit |
| 4 | PF00283.21 | 1.0 | 17 | 25 | same-strand | Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits |
| 5 | PF02419.19 | 0.65 | 11 | 13 | same-strand | PsbL protein |
| 6 | PF01788.19 | 0.88 | 15 | 177 | same-strand | PsbJ |
++ More..