Result : Q7NM41
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center Psb28 protein (Photosystem II 13 kDa protein) (Photosystem II reaction center W protein) |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 984875 |
| Right | 985174 |
| Strand | - |
| Nucleotide Sequence | ATGGCGGTAGCGCAGTTTCTTGAGGGAATCAACGAAGAGATTACAGATATCCGGGTGATGGCGTCTAAGTACGATACTTCCCGAAAGACTGCGCTCATCTACATTGCCGCGCCGAAGGCCGACCTCAACCAGGTGATGAGCTTCCGCATGCGCGACGAAGAAGGCGAAATCACCGTGCGCGACATCCGCTCCAAGCACCTCAACGGCAAATTCATCGGCCTTGAGATTAGCCACGAAATGGGTTCCGACGCCGCCTGGAATCGCTTCTACCGTTTCATGGAGCGCATGGGTTACGCCTGA |
| Sequence | MAVAQFLEGINEEITDIRVMASKYDTSRKTALIYIAAPKADLNQVMSFRMRDEEGEITVRDIRSKHLNGKFIGLEISHEMGSDAAWNRFYRFMERMGYA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl04326. Profile Description: Psb28 protein. Members of this protein family are the Psb28 protein of photosystem II. Two different protein families, apparently without homology between them, have been designated PsbW. Cyanobacterial proteins previously designated PsbW are members of the family described here. However, while members of the plant PsbW family are not found (so far) in Cyanobacteria, members of the present family do occur in plants. We therefore support the alternative designation that has emerged for this protein family, Psp28, rather than PsbW. [Energy metabolism, Photosynthesis] |
| Pubmed ID | 14621292 |
| Domain | CDD:414000 |
| Functional Category | Others |
| Uniprot ID | Q7NM41 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 984875 | 985174 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 4177600 | 4177902 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005125.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00293.30 | 1.0 | 2 | 536.0 | same-strand | NUDIX domain |
| 2 | PF01230.25 | 1.0 | 2 | 68.0 | same-strand | HIT domain |
| 3 | PF11969.10 | 1.0 | 2 | 68.0 | same-strand | Scavenger mRNA decapping enzyme C-term binding |
| 4 | PF04015.14 | 1.0 | 2 | 489.0 | opposite-strand | Domain of unknown function (DUF362) |
| 5 | PF03739.16 | 1.0 | 2 | 1467.5 | opposite-strand | Lipopolysaccharide export system permease LptF/LptG |
| 6 | PF08323.13 | 1.0 | 2 | 2709.0 | opposite-strand | Starch synthase catalytic domain |
| 7 | PF13579.8 | 1.0 | 2 | 2709.0 | opposite-strand | Glycosyl transferase 4-like domain |
| 8 | PF13439.8 | 1.0 | 2 | 2709.0 | opposite-strand | Glycosyltransferase Family 4 |
| 9 | PF13692.8 | 1.0 | 2 | 2709.0 | opposite-strand | Glycosyl transferases group 1 |
++ More..