Protein name |
Photosystem II reaction center Psb28 protein (Photosystem II 13 kDa protein) (Photosystem II reaction center W protein) |
NCBI Accession ID |
BA000045.2 |
Organism |
Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
Left |
984875 |
Right |
985174 |
Strand |
- |
Nucleotide Sequence |
ATGGCGGTAGCGCAGTTTCTTGAGGGAATCAACGAAGAGATTACAGATATCCGGGTGATGGCGTCTAAGTACGATACTTCCCGAAAGACTGCGCTCATCTACATTGCCGCGCCGAAGGCCGACCTCAACCAGGTGATGAGCTTCCGCATGCGCGACGAAGAAGGCGAAATCACCGTGCGCGACATCCGCTCCAAGCACCTCAACGGCAAATTCATCGGCCTTGAGATTAGCCACGAAATGGGTTCCGACGCCGCCTGGAATCGCTTCTACCGTTTCATGGAGCGCATGGGTTACGCCTGA |
Sequence |
MAVAQFLEGINEEITDIRVMASKYDTSRKTALIYIAAPKADLNQVMSFRMRDEEGEITVRDIRSKHLNGKFIGLEISHEMGSDAAWNRFYRFMERMGYA |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl04326. Profile Description: Psb28 protein. Members of this protein family are the Psb28 protein of photosystem II. Two different protein families, apparently without homology between them, have been designated PsbW. Cyanobacterial proteins previously designated PsbW are members of the family described here. However, while members of the plant PsbW family are not found (so far) in Cyanobacteria, members of the present family do occur in plants. We therefore support the alternative designation that has emerged for this protein family, Psp28, rather than PsbW. [Energy metabolism, Photosynthesis] |
Pubmed ID |
14621292
|
Domain |
CDD:414000 |
Functional Category |
Others |
Uniprot ID |
Q7NM41
|
ORF Length (Amino Acid) |
99 |