Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division topological specificity factor |
NCBI Accession ID | BA000045.2 |
Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
Left | 2142383 |
Right | 2142658 |
Strand | + |
Nucleotide Sequence | ATGGTCTTCGATCTGCTCGAACGCCTGTTTAACCGCAACAAGACCGGCAGTGCCACCGTCGCCAAAGATCGCCTCAAGATGGTCCTGGCGGTGGATCGCACTGAAATTGCCCCCCAGACTATCGAGCAAATCCGCAAAGAAATTCTCGATGTGATCGTGCGCTACTTCGAGATCGACGAGAATGAAAAGTTCGACGTCACCCTCGAACGGGAGCGCGGTTCGACGGCAATCATCGCAAACGTTCCGATCCGCCGCATCCGGCCTGAACATATCTAG |
Sequence | MVFDLLERLFNRNKTGSATVAKDRLKMVLAVDRTEIAPQTIEQIRKEILDVIVRYFEIDENEKFDVTLERERGSTAIIANVPIRRIRPEHI |
Source of smORF | Swiss-Prot |
Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
Pubmed ID | 14621292 |
Domain | CDD:412433 |
Functional Category | Others |
Uniprot ID | Q7NJ38 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2142383 | 2142658 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
2 | 4287774 | 4288049 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
3 | 4265680 | 4265970 | + | NZ_CP031941.1 | Nostoc sphaeroides |
4 | 4964878 | 4965168 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
5 | 3440397 | 3440681 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03775.18 | 1.0 | 5 | 881 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
2 | PF01656.25 | 1.0 | 5 | 37 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
3 | PF13614.8 | 1.0 | 5 | 37 | same-strand | AAA domain |
4 | PF10609.11 | 0.6 | 3 | 37 | same-strand | NUBPL iron-transfer P-loop NTPase |
5 | PF06564.14 | 0.6 | 3 | 37 | same-strand | Cellulose biosynthesis protein BcsQ |