Result : Q7NH97

Protein Information

• Protein name: UPF0391 membrane protein gsr2640
• Organism: Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
• Sequence: MLNLLWLVVVLMVIAALLGFGGVVSSLQSVAWFLIVAAVVLAVVGFVTGRRAL
• Source of smORF: Swiss-Prot
• Pubmed ID: 14621292
• Functional Category: Others
• Uniprot ID: Q7NH97
• ORF Length (Amino Acid): 53

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2796758	2796919	+	NC_005125.1	Gloeobacter violaceus PCC 7421
2	809615	809776	-	NC_022600.1	Gloeobacter kilaueensis JS1
3	12168425	12168559	+	NC_010162.1	Sorangium cellulosum So ce56

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_005125.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01165.22	0.67	2	2323.0	opposite-strand	Ribosomal protein S21
2	PF13083.8	0.67	2	2015.0	opposite-strand	KH domain
3	PF00886.21	0.67	2	1756.0	opposite-strand	Ribosomal protein S16
4	PF00448.24	0.67	2	213.5	opposite-strand	SRP54-type protein, GTPase domain
5	PF02978.21	0.67	2	213.5	opposite-strand	Signal peptide binding domain
6	PF02881.21	0.67	2	213.5	opposite-strand	SRP54-type protein, helical bundle domain
7	PF00294.26	0.67	2	272.0	same-strand	pfkB family carbohydrate kinase
8	PF00459.27	0.67	2	1702.0	opposite-strand	Inositol monophosphatase family