| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0367 protein gsr3177 |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 3386220 |
| Right | 3386501 |
| Strand | + |
| Nucleotide Sequence | ATGTTTACGATCGAATTGATTTTGCGCGGCAACCCCGTCGCCCTCGCGGTGCAGCGCAAGGACCAGACGGCCGCGGGCGATCTATATGCCAAAATTCGCGACGCAATGAACGCCAGCCCGCCCCGGGTGATCGAGCTTACCTGCGACAAGGTGCCGGAGAAACACCTCGCGGTGATGAGTTCCGATGTCGTGGCTGTGCAACTGACCGCCGCCAAGTCGGGGAGCGGCGCGCCCATGGGCATGCGGGCCGGTTTCTTCGCCGGTGAGAGCGAGGACGAATAA |
| Sequence | MFTIELILRGNPVALAVQRKDQTAAGDLYAKIRDAMNASPPRVIELTCDKVPEKHLAVMSSDVVAVQLTAAKSGSGAPMGMRAGFFAGESEDE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of PRK13683. Profile Description: hypothetical protein; Provisional |
| Pubmed ID | 14621292 |
| Domain | CDD:184240 |
| Functional Category | Others |
| Uniprot ID | Q7NGJ2 |
| ORF Length (Amino Acid) | 93 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3386220 | 3386501 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 3744496 | 3744780 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 2085040 | 2085321 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03881.16 | 0.67 | 2 | 2689.0 | opposite-strand | Fructosamine kinase |
| 2 | PF01636.25 | 0.67 | 2 | 2689.0 | opposite-strand | Phosphotransferase enzyme family |
| 3 | PF01451.23 | 0.67 | 2 | 2229.0 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
| 4 | PF02517.18 | 0.67 | 2 | 831.0 | opposite-strand | Type II CAAX prenyl endopeptidase Rce1-like |
| 5 | PF13419.8 | 1.0 | 3 | 37 | same-strand | Haloacid dehalogenase-like hydrolase |
| 6 | PF00702.28 | 1.0 | 3 | 37 | same-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF02781.18 | 0.67 | 2 | 162.0 | same-strand | Glucose-6-phosphate dehydrogenase, C-terminal domain |
| 8 | PF00479.24 | 0.67 | 2 | 162.0 | same-strand | Glucose-6-phosphate dehydrogenase, NAD binding domain |
| 9 | PF10128.11 | 0.67 | 2 | 1731.0 | same-strand | Glucose-6-phosphate dehydrogenase subunit |
| 10 | PF01182.22 | 0.67 | 2 | 2861.0 | same-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
| 11 | PF01728.21 | 0.67 | 2 | 4027.5 | opposite-strand | FtsJ-like methyltransferase |
| 12 | PF01479.27 | 0.67 | 2 | 4027.5 | opposite-strand | S4 domain |