Result : Q7NGJ2

Protein Information

• Protein name: UPF0367 protein gsr3177
• NCBI Accession ID: BA000045.2
• Organism: Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
• Left: 3386220
• Right: 3386501
• Strand: +
• Nucleotide Sequence: ATGTTTACGATCGAATTGATTTTGCGCGGCAACCCCGTCGCCCTCGCGGTGCAGCGCAAGGACCAGACGGCCGCGGGCGATCTATATGCCAAAATTCGCGACGCAATGAACGCCAGCCCGCCCCGGGTGATCGAGCTTACCTGCGACAAGGTGCCGGAGAAACACCTCGCGGTGATGAGTTCCGATGTCGTGGCTGTGCAACTGACCGCCGCCAAGTCGGGGAGCGGCGCGCCCATGGGCATGCGGGCCGGTTTCTTCGCCGGTGAGAGCGAGGACGAATAA
• Sequence: MFTIELILRGNPVALAVQRKDQTAAGDLYAKIRDAMNASPPRVIELTCDKVPEKHLAVMSSDVVAVQLTAAKSGSGAPMGMRAGFFAGESEDE
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of PRK13683. Profile Description: hypothetical protein; Provisional
• Pubmed ID: 14621292
• Domain: CDD:184240
• Functional Category: Others
• Uniprot ID: Q7NGJ2
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3386220	3386501	+	NC_005125.1	Gloeobacter violaceus PCC 7421
2	3744496	3744780	+	NC_022600.1	Gloeobacter kilaueensis JS1
3	2085040	2085321	-	NZ_CP018092.1	Synechococcus lividus PCC 6715

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_005125.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03881.16	0.67	2	2689.0	opposite-strand	Fructosamine kinase
2	PF01636.25	0.67	2	2689.0	opposite-strand	Phosphotransferase enzyme family
3	PF01451.23	0.67	2	2229.0	opposite-strand	Low molecular weight phosphotyrosine protein phosphatase
4	PF02517.18	0.67	2	831.0	opposite-strand	Type II CAAX prenyl endopeptidase Rce1-like
5	PF13419.8	1.0	3	37	same-strand	Haloacid dehalogenase-like hydrolase
6	PF00702.28	1.0	3	37	same-strand	haloacid dehalogenase-like hydrolase
7	PF02781.18	0.67	2	162.0	same-strand	Glucose-6-phosphate dehydrogenase, C-terminal domain
8	PF00479.24	0.67	2	162.0	same-strand	Glucose-6-phosphate dehydrogenase, NAD binding domain
9	PF10128.11	0.67	2	1731.0	same-strand	Glucose-6-phosphate dehydrogenase subunit
10	PF01182.22	0.67	2	2861.0	same-strand	Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
11	PF01728.21	0.67	2	4027.5	opposite-strand	FtsJ-like methyltransferase
12	PF01479.27	0.67	2	4027.5	opposite-strand	S4 domain