Result : Q7NEP1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MSRKCMLTGKKANNAYSVSFSHRRNKRLQMANLQWKRIWDDQQGCFVRLKLSTKAIKTLEHRSLHALAKEAGLDLSKYVVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 14621292 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7NEP1 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4045212 | 4045457 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 2661297 | 2661542 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 2056241 | 2056477 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 4 | 2553959 | 2554195 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 5 | 2576546 | 2576782 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 6 | 3172184 | 3172420 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 7 | 2033125 | 2033361 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 8 | 981958 | 982194 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 9 | 1319266 | 1319502 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 10 | 4987001 | 4987237 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 11 | 1943062 | 1943298 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 12 | 561455 | 561691 | + | NC_016025.1 | Chloracidobacterium thermophilum B |
| 13 | 1481508 | 1481744 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 14 | 5096461 | 5096697 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 15 | 582324 | 582560 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 16 | 2727967 | 2728203 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 17 | 1679515 | 1679751 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 18 | 3686248 | 3686484 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 19 | 4514647 | 4514883 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 20 | 2921224 | 2921460 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 21 | 3627669 | 3627917 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 22 | 1936427 | 1936663 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 23 | 3525408 | 3525644 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 24 | 4706129 | 4706365 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 25 | 1250703 | 1250939 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 26 | 3103818 | 3104054 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 27 | 1027946 | 1028182 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 28 | 121297 | 121533 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 29 | 2784672 | 2784908 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 30 | 641238 | 641474 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
++ More..