Result : A8ZV65
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000859.1 |
| Organism | Desulfococcus oleovorans (strain DSM 6200 / Hxd3) |
| Left | 844988 |
| Right | 845176 |
| Strand | + |
| Nucleotide Sequence | ATGAAACCAGATGAAATCAAGGCATTGAGTGCCGACGAGGCAAAACAGAAGCTTGTCGAATTGAAGGCCGCCTACTTCAACCTGCGGTTTCGGCACGAAACCGGCCAGCTGGACAACACCAGCATGTTGGAGAAGACCAAGAAGGATATTGCCAGGGTCAAGACGGTGTTAAGCGCCTATAACCGGTAG |
| Sequence | MKPDEIKALSADEAKQKLVELKAAYFNLRFRHETGQLDNTSMLEKTKKDIARVKTVLSAYNR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A8ZV65 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 214
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 844988 | 845176 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 2 | 2374725 | 2374928 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 3 | 4071591 | 4071788 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 4 | 6982749 | 6982952 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 5 | 1535010 | 1535210 | - | NZ_CP053856.1 | Rhizobium pusense |
| 6 | 72410 | 72610 | + | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 7 | 1627079 | 1627279 | - | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 8 | 2412175 | 2412378 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 9 | 2135708 | 2135914 | - | NZ_CP029256.1 | Christensenella minuta |
| 10 | 3261328 | 3261528 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 11 | 2487738 | 2487926 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 12 | 4062438 | 4062635 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 13 | 50803 | 51000 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 14 | 1226777 | 1226983 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 15 | 1438405 | 1438611 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 16 | 3659987 | 3660187 | - | NZ_AP014946.1 | Variibacter gotjawalensis |
| 17 | 948901 | 949101 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 18 | 806464 | 806664 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 19 | 365042 | 365233 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 20 | 2171368 | 2171568 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 21 | 2868068 | 2868268 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 22 | 2247123 | 2247320 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 23 | 1753348 | 1753548 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 24 | 1536143 | 1536343 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 25 | 1446033 | 1446233 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 26 | 2101434 | 2101631 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 27 | 1586406 | 1586606 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 28 | 1401188 | 1401373 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 29 | 1314261 | 1314464 | - | NZ_CP071057.1 | Marinicauda algicola |
| 30 | 1702652 | 1702846 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 31 | 1504223 | 1504423 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 32 | 1290810 | 1291010 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 33 | 295175 | 295372 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 34 | 358394 | 358591 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 35 | 398170 | 398367 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 36 | 1741313 | 1741513 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 37 | 2548754 | 2548948 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 38 | 1271017 | 1271217 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 39 | 1483379 | 1483579 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 40 | 151302 | 151499 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 41 | 157892 | 158089 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 42 | 1129224 | 1129418 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 43 | 228299 | 228502 | + | NZ_AP019367.1 | Parolsenella catena |
| 44 | 1150605 | 1150805 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 45 | 1106031 | 1106231 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 46 | 1784304 | 1784504 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 47 | 354918 | 355115 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 48 | 2476201 | 2476410 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 49 | 3427076 | 3427273 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 50 | 5867613 | 5867810 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 51 | 5590085 | 5590282 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 52 | 4198199 | 4198396 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 53 | 6281486 | 6281683 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 54 | 1525667 | 1525867 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 55 | 1939593 | 1939802 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 56 | 2006920 | 2007129 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 57 | 1546433 | 1546630 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 58 | 5157694 | 5157891 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 59 | 1737518 | 1737718 | + | NZ_CP020906.1 | Rhizobium etli |
| 60 | 1785827 | 1786027 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 61 | 1786816 | 1787016 | + | NZ_CP071604.1 | Rhizobium binae |
| 62 | 3617834 | 3618034 | + | NZ_CP071454.1 | Rhizobium lentis |
| 63 | 1781814 | 1782014 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 64 | 5723151 | 5723348 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 65 | 2370437 | 2370640 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 66 | 5134401 | 5134598 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 67 | 1959835 | 1960032 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 68 | 160875 | 161072 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 69 | 814928 | 815125 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 70 | 1167534 | 1167734 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 71 | 1822984 | 1823190 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 72 | 690248 | 690448 | + | NZ_CP009302.1 | Berryella intestinalis |
| 73 | 1318653 | 1318859 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 74 | 1520167 | 1520361 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 75 | 2694784 | 2694987 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 76 | 394355 | 394552 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 77 | 1277853 | 1278050 | - | NZ_CP029476.1 | Lactobacillus apis |
| 78 | 337160 | 337345 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 79 | 143151 | 143351 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 80 | 184965 | 185165 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 81 | 2577651 | 2577854 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 82 | 2436116 | 2436319 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 83 | 415662 | 415856 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 84 | 1908339 | 1908533 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 85 | 2290089 | 2290298 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 86 | 418891 | 419100 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 87 | 1377659 | 1377856 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 88 | 1466931 | 1467128 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 89 | 155853 | 156053 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 90 | 4056826 | 4057023 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 91 | 941205 | 941411 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 92 | 325904 | 326110 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 93 | 132456 | 132647 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 94 | 487164 | 487358 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 95 | 2099865 | 2100062 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 96 | 60463 | 60660 | + | NZ_CP036259.1 | Sporomusa termitida |
| 97 | 1474246 | 1474443 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 98 | 3453531 | 3453731 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 99 | 2574412 | 2574612 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 100 | 3966912 | 3967109 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 101 | 1103098 | 1103307 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 102 | 357549 | 357752 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 103 | 2253303 | 2253506 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 104 | 433736 | 433939 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 105 | 52654 | 52854 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 106 | 148351 | 148551 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 107 | 2304374 | 2304571 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 108 | 3231994 | 3232185 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 109 | 507428 | 507631 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 110 | 2212930 | 2213118 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 111 | 2818537 | 2818737 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 112 | 3124836 | 3125024 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 113 | 2539138 | 2539338 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 114 | 726455 | 726646 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 115 | 4717165 | 4717362 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 116 | 387886 | 388071 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 117 | 224366 | 224563 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 118 | 2084221 | 2084415 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 119 | 4080497 | 4080685 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 120 | 4510721 | 4510909 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 121 | 2213140 | 2213328 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 122 | 431300 | 431488 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 123 | 73445 | 73636 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 124 | 3085026 | 3085220 | - | NZ_CP022579.1 | Oryzomicrobium terrae |
| 125 | 1667657 | 1667854 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 126 | 1291034 | 1291225 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 127 | 202312 | 202515 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 128 | 547526 | 547735 | + | NZ_CP014324.1 | Oenococcus oeni |
| 129 | 704480 | 704668 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 130 | 161055 | 161258 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 131 | 530585 | 530740 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 132 | 1575880 | 1576068 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 133 | 3959029 | 3959217 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 134 | 3569827 | 3570015 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 135 | 2660335 | 2660535 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 136 | 2443035 | 2443229 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 137 | 2442974 | 2443168 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 138 | 2401899 | 2402093 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 139 | 574131 | 574325 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 140 | 551250 | 551444 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 141 | 1065760 | 1065954 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 142 | 1631193 | 1631396 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 143 | 282422 | 282616 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 144 | 516835 | 517029 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 145 | 565459 | 565614 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 146 | 1671213 | 1671416 | - | NZ_LT906470.1 | Veillonella rodentium |
| 147 | 1613467 | 1613670 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 148 | 1670063 | 1670266 | - | NZ_LR134375.1 | Veillonella dispar |
| 149 | 1729730 | 1729933 | - | NZ_LR778174.1 | Veillonella parvula |
| 150 | 3027263 | 3027460 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 151 | 396321 | 396509 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 152 | 871062 | 871268 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 153 | 1317456 | 1317662 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 154 | 1398805 | 1399011 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 155 | 1564044 | 1564250 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 156 | 4331495 | 4331689 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 157 | 695444 | 695650 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 158 | 2009993 | 2010199 | + | NZ_LT996885.1 | Dialister massiliensis |
| 159 | 1280168 | 1280362 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 160 | 1260685 | 1260879 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 161 | 3440736 | 3440939 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 162 | 2328947 | 2329147 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 163 | 176154 | 176354 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 164 | 753892 | 754089 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 165 | 318103 | 318300 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 166 | 742501 | 742698 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 167 | 1388394 | 1388588 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 168 | 1563886 | 1564080 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 169 | 3533083 | 3533277 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 170 | 3746377 | 3746571 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 171 | 2376984 | 2377181 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 172 | 95716 | 95877 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 173 | 4114853 | 4115047 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 174 | 1510281 | 1510487 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 175 | 179637 | 179831 | + | NZ_CP054624.1 | Cupriavidus gilardii |
| 176 | 1780916 | 1781122 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 177 | 111083 | 111289 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 178 | 1484198 | 1484404 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 179 | 573887 | 574081 | - | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 180 | 66632 | 66838 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 181 | 1857491 | 1857652 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 182 | 73783 | 73944 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 183 | 504246 | 504407 | - | NZ_LR134293.1 | Streptococcus canis |
| 184 | 672597 | 672803 | + | NZ_CP043405.1 | Streptococcus ratti |
| 185 | 75717 | 75923 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 186 | 74504 | 74665 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 187 | 874310 | 874516 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 188 | 506528 | 506722 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 189 | 1839314 | 1839475 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 190 | 109804 | 110010 | + | NZ_LS483343.1 | Streptococcus ferus |
| 191 | 2170657 | 2170821 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 192 | 85786 | 85950 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 193 | 310966 | 311121 | + | NZ_CP027563.1 | Weissella confusa |
| 194 | 1753011 | 1753220 | + | NZ_CP013237.1 | Streptococcus mutans |
| 195 | 1912576 | 1912785 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 196 | 1696200 | 1696400 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 197 | 69002 | 69163 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 198 | 80710 | 80871 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 199 | 59582 | 59743 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 200 | 1169382 | 1169543 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 201 | 155212 | 155376 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 202 | 1775646 | 1775837 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 203 | 427616 | 427807 | + | NZ_CP014164.1 | Aerococcus viridans |
| 204 | 293777 | 293971 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 205 | 812666 | 812866 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 206 | 1832749 | 1832955 | - | NZ_LT906439.1 | Streptococcus merionis |
| 207 | 857217 | 857396 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 208 | 215277 | 215468 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 209 | 1896208 | 1896402 | + | NZ_CP018839.1 | Thauera chlorobenzoica |
| 210 | 1255832 | 1256020 | + | NZ_CP064781.1 | Azospira restricta |
| 211 | 805692 | 805898 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 212 | 2907834 | 2908028 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 213 | 2265427 | 2265621 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 214 | 2452409 | 2452603 | + | NZ_CP059467.1 | Aromatoleum bremense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053856.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.99 | 212 | 1820.5 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.99 | 212 | 1820.5 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 0.99 | 212 | 1495.0 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 1.0 | 213 | 1121 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 1.0 | 214 | 430.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 1.0 | 214 | 430.0 | same-strand | KH domain |
| 7 | PF00252.20 | 1.0 | 213 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 1.0 | 213 | 19 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 1.0 | 214 | 330.0 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF17136.6 | 0.95 | 203 | 741 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 11 | PF00467.31 | 0.91 | 194 | 740.0 | same-strand | KOW motif |
| 12 | PF00673.23 | 0.99 | 212 | 1080.0 | same-strand | ribosomal L5P family C-terminus |
| 13 | PF00281.21 | 1.0 | 213 | 1080 | same-strand | Ribosomal protein L5 |
| 14 | PF00253.23 | 0.82 | 175 | 1648 | same-strand | Ribosomal protein S14p/S29e |
++ More..