Result : Q7NCH7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein H (PSII-H) |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 3201105 |
| Right | 3201341 |
| Strand | + |
| Nucleotide Sequence | ATGGCCCGTAGGACCTGGTTAGGAGACCGACTGAAGCCGCTCAACTCCGAGATTGGCAAGGCCAGCCCCGGTTGGGGGACCACCCCGATCATGGGAGCTTTGATTGCCCTTTTTGGTGTCTTTCTCATCATCATCCTGCAGATTGCCAACAACTCCTTGCTGCTTGAAGGCGTCAACGAGGGCGTGCCGCAAAGCCCGGCCGGTCAGGGTTACGGTTACTACCCGCAATCGCGCTAA |
| Sequence | MARRTWLGDRLKPLNSEIGKASPGWGTTPIMGALIALFGVFLIIILQIANNSLLLEGVNEGVPQSPAGQGYGYYPQSR |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII), required for its stability and/or assembly. PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_00752}. |
| Pubmed ID | 14621292 |
| Domain | CDD:420012 |
| Functional Category | Others |
| Uniprot ID | Q7NCH7 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3201105 | 3201341 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 1089925 | 1090161 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 1436053 | 1436256 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005125.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00111.29 | 0.67 | 2 | 2427.5 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 2 | PF00421.21 | 0.67 | 2 | 553.0 | same-strand | Photosystem II protein |
| 3 | PF02468.17 | 1.0 | 3 | 161 | opposite-strand | Photosystem II reaction centre N protein (psbN) |
| 4 | PF02416.18 | 1.0 | 3 | 82 | same-strand | mttA/Hcf106 family |
| 5 | PF01019.23 | 0.67 | 2 | 314.5 | opposite-strand | Gamma-glutamyltranspeptidase |
++ More..