Result : Q7NBY3

Protein Information

• Protein name: 30S ribosomal protein S20
• NCBI Accession ID: AE015450.2
• Organism: Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2))
• Left: 162479
• Right: 162733
• Strand: -
• Nucleotide Sequence: ATGGCTAACATAAAAGCAAACGAAAAGAGCTATCGTCAGAATCAAAAGGCAAATTTATTAACTAAAGGGTTTAAAACATCTTTAAAGAACCAACTGAAGAAAACTAAGGCTTCTAAAGATAAAAAAGATGTTGAACAAGTTTATTCTTTAGCTGATAAGCTAGCTAAAAACAACAGAATCTCTAAGAACAAAGCTCGTCGTCTTAAATCAAGAGCAGCTAGATGATCAAATTCAGCAACTGCTGCTAGTCGCTAA
• Sequence: MANIKANEKSYRQNQKANLLTKGFKTSLKNQLKKTKASKDKKDVEQVYSLADKLAKNNRISKNKARRLKSRAARWSNSATAASR
• Source of smORF: Swiss-Prot
• Function: Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}.
• Pubmed ID: 12949158
• Domain: CDD:412349
• Functional Category: Ribosomal_protein
• Uniprot ID: Q7NBY3
• ORF Length (Amino Acid): 84

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	139072	139296	-	NZ_CP059674.1	Mycoplasma tullyi
2	655748	656011	-	NZ_CP010546.1	Mycoplasma pneumoniae FH
3	460685	460951	-	NC_000908.2	Mycoplasma genitalium G37

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP010546.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00817.22	0.67	2	1194.5	same-strand	impB/mucB/samB family
2	PF00466.22	0.67	2	589.0	opposite-strand	Ribosomal protein L10
3	PF00542.21	0.67	2	190.5	opposite-strand	Ribosomal protein L7/L12 C-terminal domain
4	PF16320.7	0.67	2	190.5	opposite-strand	Ribosomal protein L7/L12 dimerisation domain
5	PF01783.25	0.67	2	12.5	opposite-strand	Ribosomal L32p protein family