Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | AE015450.2 |
Organism | Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) |
Left | 162479 |
Right | 162733 |
Strand | - |
Nucleotide Sequence | ATGGCTAACATAAAAGCAAACGAAAAGAGCTATCGTCAGAATCAAAAGGCAAATTTATTAACTAAAGGGTTTAAAACATCTTTAAAGAACCAACTGAAGAAAACTAAGGCTTCTAAAGATAAAAAAGATGTTGAACAAGTTTATTCTTTAGCTGATAAGCTAGCTAAAAACAACAGAATCTCTAAGAACAAAGCTCGTCGTCTTAAATCAAGAGCAGCTAGATGATCAAATTCAGCAACTGCTGCTAGTCGCTAA |
Sequence | MANIKANEKSYRQNQKANLLTKGFKTSLKNQLKKTKASKDKKDVEQVYSLADKLAKNNRISKNKARRLKSRAARWSNSATAASR |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | 12949158 |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q7NBY3 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 139072 | 139296 | - | NZ_CP059674.1 | Mycoplasma tullyi |
2 | 655748 | 656011 | - | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
3 | 460685 | 460951 | - | NC_000908.2 | Mycoplasma genitalium G37 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00817.22 | 0.67 | 2 | 1194.5 | same-strand | impB/mucB/samB family |
2 | PF00466.22 | 0.67 | 2 | 589.0 | opposite-strand | Ribosomal protein L10 |
3 | PF00542.21 | 0.67 | 2 | 190.5 | opposite-strand | Ribosomal protein L7/L12 C-terminal domain |
4 | PF16320.7 | 0.67 | 2 | 190.5 | opposite-strand | Ribosomal protein L7/L12 dimerisation domain |
5 | PF01783.25 | 0.67 | 2 | 12.5 | opposite-strand | Ribosomal L32p protein family |