Result : Q7NB34
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L33 1 |
| NCBI Accession ID | AE015450.2 |
| Organism | Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) |
| Left | 626342 |
| Right | 626503 |
| Strand | - |
| Nucleotide Sequence | ATGGCACAAAAACGTGGTACCAGATTAGGTTGCAATGACTGTAATGAAATTAATTACATTACTAGAAAGAATGCAAAGAAAAACCCAGAAAAACTAAGTCTAAACAAATATTGTTCTAGATGCCGCGGAACTACAGTTCACAAAGAGGTGAAACGTAAATAA |
| Sequence | MAQKRGTRLGCNDCNEINYITRKNAKKNPEKLSLNKYCSRCRGTTVHKEVKRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 12949158 |
| Domain | CDD:412348 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7NB34 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 184
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 584928 | 585089 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 2 | 535364 | 535525 | - | NZ_CP059674.1 | Mycoplasma tullyi |
| 3 | 568978 | 569139 | - | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 4 | 408793 | 408954 | - | NC_000908.2 | Mycoplasma genitalium G37 |
| 5 | 745339 | 745500 | - | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 6 | 842469 | 842630 | - | NZ_LR215023.1 | Mycoplasma iowae |
| 7 | 662118 | 662279 | - | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 8 | 511376 | 511537 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 9 | 1332868 | 1332999 | + | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 10 | 794900 | 795052 | - | NZ_AP022325.1 | Mycoplasmopsis felis |
| 11 | 1378223 | 1378363 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 12 | 2481833 | 2481982 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 13 | 1208797 | 1208946 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 14 | 1288894 | 1289043 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 15 | 2261640 | 2261789 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 16 | 2937948 | 2938097 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 17 | 1716621 | 1716770 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 18 | 1706651 | 1706800 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 19 | 370821 | 370961 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 20 | 1274289 | 1274438 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 21 | 2052708 | 2052857 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 22 | 1678000 | 1678131 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 23 | 1460124 | 1460255 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 24 | 1412244 | 1412393 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 25 | 504368 | 504532 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 26 | 1351956 | 1352099 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 27 | 621745 | 621885 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 28 | 2486120 | 2486251 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 29 | 3407775 | 3407924 | - | NZ_CP053989.1 | Niallia circulans |
| 30 | 350767 | 350925 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 31 | 2475502 | 2475633 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 32 | 3462703 | 3462834 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 33 | 1268878 | 1269018 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 34 | 382593 | 382742 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 35 | 583287 | 583457 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 36 | 1358160 | 1358312 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 37 | 2176350 | 2176499 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 38 | 359502 | 359672 | + | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 39 | 406281 | 406451 | + | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 40 | 391930 | 392100 | + | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 41 | 502410 | 502580 | + | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
| 42 | 1389102 | 1389251 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 43 | 832498 | 832650 | + | NZ_CP011368.1 | Mycoplasmopsis canis |
| 44 | 1735193 | 1735324 | - | NZ_CP012117.1 | Dermabacter vaginalis |
| 45 | 116766 | 116918 | - | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 46 | 1919269 | 1919418 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 47 | 3145653 | 3145802 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 48 | 384423 | 384560 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 49 | 23041 | 23190 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 50 | 804150 | 804281 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 51 | 727115 | 727264 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 52 | 1317294 | 1317452 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 53 | 1479048 | 1479197 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 54 | 326749 | 326907 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 55 | 2353708 | 2353866 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 56 | 484368 | 484517 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 57 | 478238 | 478396 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 58 | 453617 | 453775 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 59 | 2014647 | 2014778 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 60 | 3704768 | 3704920 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 61 | 1081283 | 1081435 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 62 | 929885 | 930034 | - | NZ_CP008802.1 | Actinotignum schaalii |
| 63 | 2020124 | 2020273 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 64 | 2527408 | 2527557 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 65 | 455016 | 455174 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 66 | 909 | 1079 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 67 | 1277847 | 1277996 | + | NZ_LR134483.1 | Listeria grayi |
| 68 | 1342344 | 1342493 | + | NZ_LT906444.1 | Listeria welshimeri |
| 69 | 1363826 | 1363975 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 70 | 1127430 | 1127579 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 71 | 1107501 | 1107659 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 72 | 1273075 | 1273224 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 73 | 1390201 | 1390350 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 74 | 391149 | 391307 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 75 | 399052 | 399210 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 76 | 414076 | 414234 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 77 | 422516 | 422674 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 78 | 427619 | 427759 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 79 | 2623848 | 2623997 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 80 | 1545342 | 1545491 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 81 | 1508308 | 1508457 | + | NZ_CP016538.2 | Planococcus maritimus |
| 82 | 1518340 | 1518489 | + | NZ_CP059540.1 | Planococcus maritimus |
| 83 | 1461233 | 1461382 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 84 | 1516149 | 1516298 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 85 | 223658 | 223807 | - | NZ_CP013661.2 | Planococcus kocurii |
| 86 | 1559065 | 1559214 | + | NZ_CP019401.1 | Planococcus faecalis |
| 87 | 1671966 | 1672115 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 88 | 410131 | 410289 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 89 | 449093 | 449260 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 90 | 1262245 | 1262394 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 91 | 4102967 | 4103110 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 92 | 2637648 | 2637815 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 93 | 1652467 | 1652637 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 94 | 2444444 | 2444593 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 95 | 632372 | 632521 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 96 | 1650992 | 1651141 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 97 | 54285 | 54443 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 98 | 1309116 | 1309274 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 99 | 435660 | 435818 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 100 | 316235 | 316393 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 101 | 621010 | 621162 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 102 | 1089178 | 1089336 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 103 | 355542 | 355691 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 104 | 1153881 | 1154012 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 105 | 1126470 | 1126619 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 106 | 2528311 | 2528460 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 107 | 407181 | 407339 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 108 | 510667 | 510837 | + | NZ_CP012544.1 | Campylobacter showae |
| 109 | 1915853 | 1916023 | - | NZ_CP012543.1 | Campylobacter rectus |
| 110 | 712833 | 712985 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 111 | 2089167 | 2089316 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 112 | 1795875 | 1796024 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 113 | 355622 | 355780 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 114 | 2554443 | 2554616 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 115 | 1675164 | 1675295 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 116 | 1733283 | 1733432 | - | NZ_CP016540.2 | Planococcus versutus |
| 117 | 4577857 | 4578006 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 118 | 53864 | 54016 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 119 | 2303208 | 2303357 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 120 | 1668630 | 1668803 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 121 | 2303220 | 2303369 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 122 | 50167 | 50325 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 123 | 24682 | 24816 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 124 | 1457833 | 1457982 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 125 | 552503 | 552652 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 126 | 1409375 | 1409533 | - | NZ_CP053826.1 | Campylobacter curvus |
| 127 | 238738 | 238872 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 128 | 2507356 | 2507487 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 129 | 528847 | 528978 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 130 | 1958185 | 1958334 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 131 | 6055338 | 6055487 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 132 | 1138950 | 1139099 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 133 | 3227382 | 3227513 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 134 | 1394814 | 1394972 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 135 | 394443 | 394595 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 136 | 1902230 | 1902379 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 137 | 1378171 | 1378320 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 138 | 2654555 | 2654692 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 139 | 1059268 | 1059411 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 140 | 3253729 | 3253881 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 141 | 4437819 | 4437983 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 142 | 1255517 | 1255648 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 143 | 526529 | 526681 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 144 | 825744 | 825893 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 145 | 353647 | 353796 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 146 | 668565 | 668702 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 147 | 2441062 | 2441211 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 148 | 791433 | 791582 | + | NC_022549.1 | Acholeplasma brassicae |
| 149 | 2460487 | 2460642 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 150 | 1279102 | 1279233 | - | NZ_CP011391.1 | Faecalibaculum rodentium |
| 151 | 2435662 | 2435838 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 152 | 1097060 | 1097236 | - | NZ_CP019914.1 | Brachyspira hampsonii |
| 153 | 2689937 | 2690113 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 154 | 6265362 | 6265526 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 155 | 63193 | 63327 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 156 | 113063 | 113227 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 157 | 864124 | 864273 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 158 | 2133019 | 2133186 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 159 | 2304735 | 2304887 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 160 | 250206 | 250337 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 161 | 328325 | 328462 | + | NZ_CP054142.1 | Treponema parvum |
| 162 | 621215 | 621349 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 163 | 4940291 | 4940455 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 164 | 3607665 | 3607829 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 165 | 3594798 | 3594962 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 166 | 1071014 | 1071166 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 167 | 1980872 | 1981036 | + | NZ_CP038452.1 | Thermus caldilimi |
| 168 | 492276 | 492443 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 169 | 4032702 | 4032851 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 170 | 683739 | 683888 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 171 | 1227864 | 1228016 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 172 | 1318020 | 1318187 | - | NZ_CP059443.1 | Campylobacter fetus |
| 173 | 705338 | 705487 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 174 | 1466027 | 1466194 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 175 | 836631 | 836780 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 176 | 1256805 | 1256954 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 177 | 2714930 | 2715067 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 178 | 1063653 | 1063802 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 179 | 2456212 | 2456382 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 180 | 2624033 | 2624191 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 181 | 446976 | 447149 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 182 | 2563046 | 2563189 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 183 | 448082 | 448249 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 184 | 1367818 | 1367958 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 185 | 1501184 | 1501318 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
++ More..