ProsmORF-pred
Result : Q7NAN6
Protein Information
Information Type Description
Protein name Nucleoid-associated protein MYCGA6000
NCBI Accession ID AE015450.2
Organism Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2))
Left 843185
Right 843487
Strand -
Nucleotide Sequence ATGAATTTTCAAAATTTAGCTAACCAAATGAAAAAGATGCAACGCGAAATGGAAAAGAAGCTTGCAGAATTTGAAGAAAAAGAATATCAATACGAATACAAGAAGTTAATTAAAACAACACTTAAAGGCAATCTGAGAATTGTTAAGCTTGAGATCAATAAAGATCTAATCGATCCAGAAGATCCAGATACTTTACAAGATATGGTAACTGAAGCGATTAATGAAGCGCTTGGTGATCTTGAAAAGAAAAGAGATGAACTCTCTAACTCAATTACCCCACCAATTAAATTTCCTGGATTTTAG
Sequence MNFQNLANQMKKMQREMEKKLAEFEEKEYQYEYKKLIKTTLKGNLRIVKLEINKDLIDPEDPDTLQDMVTEAINEALGDLEKKRDELSNSITPPIKFPGF
Source of smORF Swiss-Prot
Function Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}.
Pubmed ID 12949158
Domain CDD:412410
Functional Category DNA-binding
Uniprot ID Q7NAN6
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 806441 806743 - NC_018406.1 Mycoplasma gallisepticum VA94_7994-1-7P
2 756014 756316 - NZ_CP059674.1 Mycoplasma tullyi
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_018406.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13662.8 1.0 2 291.0 same-strand Toprim domain
2 PF00004.31 1.0 2 3488 same-strand ATPase family associated with various cellular activities (AAA)
3 PF05496.14 1.0 2 3527.0 same-strand Holliday junction DNA helicase RuvB P-loop domain
4 PF05491.15 1.0 2 3527.0 same-strand RuvB C-terminal winged helix domain
5 PF17864.3 1.0 2 3527.0 same-strand RuvB AAA lid domain
6 PF07728.16 1.0 2 3527.0 same-strand AAA domain (dynein-related subfamily)
++ More..