Result : Q7N9B5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein TusB (tRNA 2-thiouridine synthesizing protein B) |
| NCBI Accession ID | BX571860.1 |
| Organism | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Left | 106097 |
| Right | 106384 |
| Strand | + |
| Nucleotide Sequence | ATGCTATATACTGTTGGCCGATCGCCTTATCAATGTGATTTCAATGTGATATCCAAGCTGCTTGCCCGTGGTGATGACATCTTGTTTATTCAGGATGGTGTGCTGGCAGGTATTGAGGGTAATTGCTATCTGTCGGCGTTGATCAGTTGTGGTGCTGCCTTGTATGCACTGAAAGAAGATATTGAGGCGCGGGGATTGGACGATCAGGTTTCAGACAAAGTGCAAGTGATCGACTATACTGACTTTGTTAACCTGACGGTAAAACACCATCAACAATTCGCTTGGTAG |
| Sequence | MLYTVGRSPYQCDFNVISKLLARGDDILFIQDGVLAGIEGNCYLSALISCGAALYALKEDIEARGLDDQVSDKVQVIDYTDFVNLTVKHHQQFAW |
| Source of smORF | Swiss-Prot |
| Function | Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. {ECO:0000255|HAMAP-Rule:MF_01564}. |
| Pubmed ID | 14528314 |
| Domain | CDD:412512 |
| Functional Category | Others |
| Uniprot ID | Q7N9B5 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 455530 | 455817 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 2 | 1498530 | 1498817 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 3 | 366997 | 367284 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 4 | 3644423 | 3644710 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 5 | 351835 | 352122 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 6 | 3105441 | 3105728 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 7 | 3919604 | 3919891 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 8 | 3871292 | 3871579 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 9 | 1197077 | 1197364 | - | NZ_CP019706.1 | Pantoea alhagi |
| 10 | 36002 | 36289 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 3664781 | 3665068 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 12 | 307256 | 307543 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 13 | 4299112 | 4299399 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 14 | 468689 | 468976 | + | NZ_CP026377.1 | Mixta gaviniae |
| 15 | 3491302 | 3491589 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 16 | 2514782 | 2515069 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 17 | 1646274 | 1646561 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 18 | 4317674 | 4317961 | - | NC_015968.1 | Enterobacter soli |
| 19 | 4407227 | 4407514 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 20 | 2865771 | 2866058 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 21 | 4728211 | 4728498 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 22 | 3537933 | 3538220 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 23 | 412710 | 412997 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 24 | 3474678 | 3474965 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 25 | 4947650 | 4947937 | - | NZ_LR134494.1 | Serratia quinivorans |
| 26 | 5019695 | 5019982 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 27 | 2380862 | 2381149 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 28 | 4194712 | 4194999 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 29 | 365226 | 365513 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 30 | 69717 | 70004 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 31 | 4065155 | 4065442 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 32 | 1452967 | 1453254 | - | NZ_CP053416.1 | Salmonella bongori |
| 33 | 3443955 | 3444242 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 34 | 2457522 | 2457809 | - | NZ_CP049115.1 | Pantoea stewartii |
| 35 | 4597142 | 4597429 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 36 | 663621 | 663908 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 37 | 3604053 | 3604346 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 38 | 3962761 | 3963048 | - | NZ_LR134340.1 | Escherichia marmotae |
| 39 | 96653 | 96940 | + | NZ_CP015581.1 | Tatumella citrea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005126.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04102.14 | 0.92 | 35 | 2759.5 | opposite-strand | SlyX |
| 2 | PF00254.30 | 0.97 | 37 | 1663.5 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 3 | PF01346.20 | 0.97 | 37 | 1663.5 | same-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 4 | PF08348.13 | 1.0 | 38 | 753 | same-strand | YheO-like PAS domain |
| 5 | PF13309.8 | 1.0 | 38 | 753 | same-strand | HTH domain |
| 6 | PF13384.8 | 0.89 | 34 | 754 | same-strand | Homeodomain-like domain |
| 7 | PF02635.17 | 1.0 | 38 | 202.0 | same-strand | DsrE/DsrF-like family |
| 8 | PF00164.27 | 1.0 | 38 | 126 | same-strand | Ribosomal protein S12/S23 |
| 9 | PF00177.23 | 1.0 | 38 | 597 | same-strand | Ribosomal protein S7p/S5e |
| 10 | PF00009.29 | 1.0 | 38 | 2292.5 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03764.20 | 1.0 | 38 | 1164 | same-strand | Elongation factor G, domain IV |
| 12 | PF14492.8 | 1.0 | 38 | 1164 | same-strand | Elongation Factor G, domain III |
| 13 | PF00679.26 | 1.0 | 38 | 1164 | same-strand | Elongation factor G C-terminus |
| 14 | PF03144.27 | 1.0 | 38 | 2292.5 | same-strand | Elongation factor Tu domain 2 |
| 15 | PF03143.19 | 1.0 | 38 | 3347 | same-strand | Elongation factor Tu C-terminal domain |
| 16 | PF01926.25 | 1.0 | 38 | 3347 | same-strand | 50S ribosome-binding GTPase |
++ More..