Result : Q7N5Z2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | BX571865.1 |
| Organism | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Left | 39744 |
| Right | 40022 |
| Strand | + |
| Nucleotide Sequence | ATGATTAAATATGGGGTAACAATTTATGTTTATGGCCGGGTTCAGGGAGTTGGATTTCGCTATCAAACTTTTCGTTGGGCGAAACTTAATAGGCTGACAGGTTATGTCTGTAATTTGCATGACGGTAGTGTCAAAATCGTAGCTTATGGTGATAGTGAACAACTAAATACATTAACCCATTGGTTGGAGCAGGGTGGTCCTCCAGGAGCACGAATAGATAACTTTTCATCTCAATCCTGCGCAGTGGAGGATATTGCAGATTTTATTGTCCGCCACTGA |
| Sequence | MIKYGVTIYVYGRVQGVGFRYQTFRWAKLNRLTGYVCNLHDGSVKIVAYGDSEQLNTLTHWLEQGGPPGARIDNFSSQSCAVEDIADFIVRH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 14528314 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q7N5Z2 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2129027 | 2129305 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 2 | 5047593 | 5047871 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 3 | 3145870 | 3146148 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 4 | 2016879 | 2017157 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 5 | 1649087 | 1649365 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 6 | 1747492 | 1747773 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 7 | 2055613 | 2055891 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 8 | 750095 | 750361 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 9 | 1766846 | 1767124 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 10 | 790202 | 790480 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 11 | 2954070 | 2954348 | - | NZ_LS483422.1 | Providencia heimbachae |
| 12 | 2234808 | 2235086 | + | NZ_CP029736.1 | Providencia rettgeri |
| 13 | 3074476 | 3074736 | - | NZ_CP048796.1 | Providencia vermicola |
| 14 | 3640086 | 3640364 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 15 | 3322167 | 3322448 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 16 | 4531101 | 4531382 | + | NZ_CP033744.1 | Citrobacter freundii |
| 17 | 1614283 | 1614564 | + | NC_015968.1 | Enterobacter soli |
| 18 | 830404 | 830685 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 19 | 2996337 | 2996570 | - | NZ_LR134201.1 | Cedecea lapagei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005126.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12462.10 | 0.63 | 12 | 1667.0 | same-strand | DNA helicase IV / RNA helicase N terminal |
| 2 | PF13380.8 | 0.84 | 16 | 673.5 | same-strand | CoA binding domain |
| 3 | PF02629.21 | 0.79 | 15 | 701 | same-strand | CoA binding domain |
| 4 | PF08755.13 | 0.95 | 18 | 235.0 | opposite-strand | Hemimethylated DNA-binding protein YccV like |
| 5 | PF04358.15 | 1.0 | 19 | 13 | opposite-strand | DsrC like protein |
++ More..