Result : A8ZUM8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000859.1 |
| Organism | Desulfococcus oleovorans (strain DSM 6200 / Hxd3) |
| Left | 747924 |
| Right | 748214 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGCTGAAGCCTTAAAATTTTTTATCGCGTGTGTGACAGCGGCTGGTTTTGGAATCGCCATCGCGGCGTTTGGTTGCGGCATCGGCCAGGGTCTTGGCCTGAAGGCGGCGGCCGAAGGCGTTGCCCGCAATCCCGAAGCATCCGGTAAGATCACCGTGACCATGCTCATCGGTCTGGCCATGATCGAGTCGCTCTGTATTTACGCGCTGGTCGTTGCCCTGATCCTGATCTTTGCGTCCCCCATGACGGCAACGGTTACCGGTCTGCTGACAGGTGCCGGTCACTAA |
| Sequence | MEAEALKFFIACVTAAGFGIAIAAFGCGIGQGLGLKAAAEGVARNPEASGKITVTMLIGLAMIESLCIYALVVALILIFASPMTATVTGLLTGAGH |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | A8ZUM8 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 747924 | 748214 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 2 | 7319733 | 7320014 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 3 | 7293020 | 7293301 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 4 | 8257448 | 8257690 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 5 | 79156 | 79443 | + | NZ_CP061799.1 | Desulfonema limicola |
| 6 | 3186737 | 3186988 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 7 | 60275 | 60559 | - | NZ_CP061800.1 | Desulfonema magnum |
| 8 | 3022813 | 3023094 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 9 | 3677031 | 3677309 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 10 | 236369 | 236614 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 11 | 2037054 | 2037323 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 12 | 3362343 | 3362576 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 13 | 3372673 | 3372906 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 14 | 364542 | 364775 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 15 | 128364 | 128606 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 16 | 3775596 | 3775871 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 17 | 4910179 | 4910412 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 18 | 4338269 | 4338502 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 19 | 4469752 | 4469985 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 20 | 533634 | 533909 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 21 | 2049342 | 2049590 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 22 | 1956271 | 1956543 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 23 | 1121382 | 1121648 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 24 | 19198 | 19464 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 25 | 1607895 | 1608128 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 26 | 637122 | 637355 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 27 | 2137236 | 2137505 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 28 | 12493 | 12729 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 29 | 537710 | 537943 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 30 | 2248501 | 2248773 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 31 | 1450485 | 1450745 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 32 | 3417702 | 3417962 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 33 | 3477700 | 3477945 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 34 | 475921 | 476175 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 35 | 4767655 | 4767909 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 36 | 726454 | 726693 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 37 | 385990 | 386256 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 38 | 2140484 | 2140732 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 39 | 2767488 | 2767754 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 40 | 347771 | 348037 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 41 | 249734 | 249982 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 42 | 250039 | 250287 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 43 | 177150 | 177416 | + | NZ_LT635475.1 | Ezakiella massiliensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09527.12 | 0.85 | 34 | 1224 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 2 | PF03899.17 | 0.95 | 38 | 823 | same-strand | ATP synthase I chain |
| 3 | PF00119.22 | 0.97 | 39 | 117.0 | same-strand | ATP synthase A chain |
++ More..