Result : Q7M9M3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | BX571659.1 |
| Organism | Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) (Vibrio succinogenes) |
| Left | 79425 |
| Right | 79700 |
| Strand | - |
| Nucleotide Sequence | ATGGCTAATCATAAATCAGCTGAAAAAAGAATCCGCCAAACATTGAAAAGAACTGAGAGAAATCGATATTATAGAACTCGAATCAAAAACATCACCAAGGCCGTCAAAGAAGCCGTAGCCAGCAATGATGCCACTAAAGCAGAAGAGGCTCTAAAAGTCGCCAACAAAGATCTTCATAAATTCGTTAGCAAGGGTATTCTTCCTAAAAACACGGCGGCACGAAAAGTGAGCCGACTTCACGCTTCCGTGAAAAAACTCTCCGCCCAGATCGCTTAA |
| Sequence | MANHKSAEKRIRQTLKRTERNRYYRTRIKNITKAVKEAVASNDATKAEEALKVANKDLHKFVSKGILPKNTAARKVSRLHASVKKLSAQIA |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 14500908 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7M9M3 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 110
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 774078 | 774353 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 2 | 758353 | 758625 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 3 | 1330132 | 1330401 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 4 | 664699 | 664974 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 5 | 75769 | 76038 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 6 | 179628 | 179900 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 7 | 1040104 | 1040376 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 8 | 1701706 | 1701978 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 9 | 41845 | 42117 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 10 | 1598851 | 1599126 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 11 | 797337 | 797609 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 12 | 81476 | 81745 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 13 | 2096406 | 2096675 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 14 | 14730 | 15002 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 15 | 1084458 | 1084730 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 16 | 100231 | 100500 | + | NZ_CP053826.1 | Campylobacter curvus |
| 17 | 1478445 | 1478708 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 18 | 35691 | 35963 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 19 | 17336 | 17599 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 20 | 1595432 | 1595695 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 21 | 1680501 | 1680770 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 22 | 169687 | 169956 | + | NZ_CP012541.1 | Campylobacter concisus |
| 23 | 16257 | 16520 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 24 | 97115 | 97381 | + | NZ_CP012544.1 | Campylobacter showae |
| 25 | 650266 | 650529 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 26 | 2275195 | 2275467 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 27 | 2455669 | 2455935 | + | NZ_CP012543.1 | Campylobacter rectus |
| 28 | 86877 | 87152 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 29 | 1127215 | 1127478 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 30 | 101652 | 101918 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 31 | 13998 | 14261 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 32 | 15553 | 15816 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 33 | 1682366 | 1682632 | + | NZ_CP059443.1 | Campylobacter fetus |
| 34 | 1466505 | 1466774 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 35 | 126554 | 126829 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 36 | 129052 | 129327 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 37 | 2065288 | 2065557 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 38 | 2108133 | 2108393 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 39 | 1988164 | 1988424 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 40 | 1721124 | 1721390 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 41 | 866573 | 866842 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 42 | 1347256 | 1347519 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 43 | 646603 | 646878 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 44 | 1391430 | 1391696 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 45 | 15100 | 15363 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 46 | 73252 | 73527 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 47 | 2656392 | 2656667 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 48 | 712878 | 713150 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 49 | 17039 | 17305 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 50 | 146867 | 147127 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 51 | 2102622 | 2102882 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 52 | 2119133 | 2119393 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 53 | 250502 | 250762 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 54 | 183444 | 183716 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 55 | 231177 | 231437 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 56 | 2130768 | 2131028 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 57 | 157840 | 158100 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 58 | 192109 | 192369 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 59 | 186104 | 186364 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 60 | 278176 | 278436 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 61 | 205401 | 205661 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 62 | 133159 | 133419 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 63 | 233125 | 233385 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 64 | 198098 | 198358 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 65 | 837733 | 838005 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 66 | 166261 | 166521 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 67 | 197181 | 197441 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 68 | 243941 | 244204 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 69 | 92959 | 93219 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 70 | 1291369 | 1291641 | + | NC_012115.1 | Nautilia profundicola AmH |
| 71 | 1871789 | 1872049 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 72 | 304156 | 304422 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 73 | 308302 | 308565 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 74 | 172640 | 172900 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 75 | 285085 | 285345 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 76 | 1538495 | 1538758 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 77 | 243270 | 243530 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 78 | 214076 | 214336 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 79 | 191053 | 191313 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 80 | 231830 | 232090 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 81 | 281129 | 281389 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 82 | 2125885 | 2126154 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 83 | 238190 | 238450 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 84 | 863454 | 863714 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 85 | 981 | 1241 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 86 | 91400 | 91660 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 87 | 2655629 | 2655889 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 88 | 3439679 | 3439945 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 89 | 1851665 | 1851934 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 90 | 5868392 | 5868652 | + | NZ_CP030265.1 | Skermanella pratensis |
| 91 | 2353070 | 2353333 | + | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 92 | 3292055 | 3292321 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 93 | 963775 | 964038 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 94 | 3748933 | 3749205 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 95 | 1040107 | 1040373 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 96 | 3543739 | 3544005 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 97 | 1914759 | 1915025 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 98 | 2411616 | 2411879 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 99 | 1081433 | 1081693 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 100 | 847511 | 847771 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 101 | 374857 | 375129 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 102 | 683072 | 683344 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 103 | 2802753 | 2803016 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 104 | 1765791 | 1766060 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 105 | 1718846 | 1719106 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 106 | 4364983 | 4365255 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 107 | 145768 | 146034 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 108 | 802393 | 802656 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 109 | 795558 | 795821 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 110 | 2529646 | 2529909 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005090.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03462.20 | 0.75 | 83 | 17 | same-strand | PCRF domain |
| 2 | PF00472.22 | 0.75 | 83 | 17 | same-strand | RF-1 domain |
| 3 | PF02878.18 | 0.63 | 69 | 91 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 4 | PF02880.18 | 0.63 | 69 | 91 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 5 | PF02879.18 | 0.63 | 69 | 91 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
++ More..