Result : Q7DDQ4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein FtsL |
| NCBI Accession ID | AE002098.2 |
| Organism | Neisseria meningitidis serogroup B (strain MC58) |
| Left | 419499 |
| Right | 419768 |
| Strand | + |
| Nucleotide Sequence | ATGGCAATGAACAAATTGAATTTCCTTCTGCTGCTTGCGGTGTGCGTTTCCGCTTTTTCCGTTGTGATGCAGCAAAACCAGTACAGGCTCAATTTCACAGCTTTGGATAAGGCGAAAAAACAGGAAATCGCCTTGGAGCAGGATTATGCGCAAATGAGGCTGCAACAGGCGCGTTTGGCGAACCACGAAGCGATCAGGGCGGCGGCAGAAAAACAAAACCTCCATCCGCCGGTTTCGGGCAATACCTTTATGGTGGAGCATCAAAGATAG |
| Sequence | MAMNKLNFLLLLAVCVSAFSVVMQQNQYRLNFTALDKAKKQEIALEQDYAQMRLQQARLANHEAIRAAAEKQNLHPPVSGNTFMVEHQR |
| Source of smORF | Swiss-Prot |
| Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00910}. |
| Pubmed ID | 10710307 |
| Domain | CDD:416267 |
| Functional Category | Others |
| Uniprot ID | Q7DDQ4 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 707604 | 707834 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 2 | 1455260 | 1455529 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 3 | 540982 | 541212 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 4 | 1608367 | 1608621 | - | NZ_CP031253.1 | Neisseria lactamica |
| 5 | 1292001 | 1292255 | - | NZ_LS483369.1 | Neisseria cinerea |
| 6 | 2413343 | 2413606 | + | NZ_CP072524.1 | Neisseria sicca |
| 7 | 1483876 | 1484139 | + | NZ_CP022278.1 | Neisseria chenwenguii |
| 8 | 730668 | 730931 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 9 | 1540692 | 1540955 | - | NZ_CP039887.1 | Neisseria subflava |
| 10 | 1556906 | 1557169 | - | NZ_CP039886.1 | Neisseria flavescens |
| 11 | 778942 | 779205 | - | NZ_CP031699.1 | Neisseria animalis |
| 12 | 770711 | 770971 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 13 | 568157 | 568417 | - | NZ_LR134313.1 | Neisseria canis |
| 14 | 2201637 | 2201897 | + | NZ_LR134516.1 | Neisseria animaloris |
| 15 | 385742 | 386002 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 16 | 171739 | 171999 | - | NZ_CP031700.1 | Neisseria zalophi |
| 17 | 2371328 | 2371588 | + | NZ_CP060414.1 | Neisseria musculi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031325.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08245.14 | 1.0 | 17 | 1860 | same-strand | Mur ligase middle domain |
| 2 | PF02875.23 | 1.0 | 17 | 1860 | same-strand | Mur ligase family, glutamate ligase domain |
| 3 | PF01225.27 | 0.65 | 11 | 1864 | same-strand | Mur ligase family, catalytic domain |
| 4 | PF00905.24 | 1.0 | 17 | 61 | same-strand | Penicillin binding protein transpeptidase domain |
| 5 | PF03717.17 | 1.0 | 17 | 61 | same-strand | Penicillin-binding Protein dimerisation domain |
| 6 | PF01795.21 | 0.94 | 16 | 49.0 | same-strand | MraW methylase family |
| 7 | PF02381.20 | 0.94 | 16 | 1005.0 | same-strand | MraZ protein, putative antitoxin-like |
| 8 | PF02636.19 | 1.0 | 17 | 1813 | opposite-strand | Putative S-adenosyl-L-methionine-dependent methyltransferase |
++ More..