Protein Information |
Information Type | Description |
---|---|
Protein name | Broad mercury transporter MerE |
NCBI Accession ID | AP000342.1 |
Organism | Shigella flexneri |
Left | 3818 |
Right | 4054 |
Strand | + |
Nucleotide Sequence | GTGAACGCCCCTGACAAACTGCCGCCCGAGACGCGCCAACCCGTTTCCGGCTACCTGTGGGGTGCGCTGGCCGTGTTGACCTGCCCCTGCCATCTGCCGATTCTCGCCGCCGTGCTGGCCGGGACGACCGCCGGTGCCTTCCTTGGCGAGCATTGGGGTGTTGCCGCGCTCGCGCTGACCGGCTTGTTCGTTCTGGCCGTAACGCGGCTGCTGCGCGCCTTCCGGGGCGGATCATGA |
Sequence | MNAPDKLPPETRQPVSGYLWGALAVLTCPCHLPILAAVLAGTTAGAFLGEHWGVAALALTGLFVLAVTRLLRAFRGGS |
Source of smORF | Swiss-Prot |
Function | Broad mercury transporter that mediates the transport of both CH(3)Hg(I) and Hg(II) across the membrane. {ECO:0000269|Pubmed:19265693}. |
Pubmed ID | 19265693 |
Domain | CDD:331288 |
Functional Category | Others |
Uniprot ID | Q7AKA4 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 15631 | 15867 | + | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
2 | 916021 | 916257 | - | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
3 | 821863 | 822099 | - | NZ_CP028901.1 | Algicoccus marinus |
4 | 5612234 | 5612470 | + | NZ_AP017928.1 | Methylocaldum marinum |
5 | 40808 | 41044 | - | NC_008341.1 | Nitrosomonas eutropha C91 |
6 | 49605 | 49841 | - | NZ_CP011599.1 | Phytobacter ursingii |
7 | 87965 | 88201 | + | NZ_CP022359.1 | Shewanella bicestrii |
8 | 207158 | 207394 | - | NZ_CP011601.1 | Phytobacter ursingii |
9 | 112684 | 112920 | - | NZ_CP061512.1 | Mixta calida |
10 | 153078 | 153314 | + | NZ_CP041248.1 | Raoultella electrica |
11 | 87623 | 87859 | - | NZ_CP041248.1 | Raoultella electrica |
12 | 296932 | 297168 | - | NZ_CP029396.2 | Acinetobacter defluvii |
13 | 306615 | 306851 | - | NZ_CP029396.2 | Acinetobacter defluvii |
14 | 1373301 | 1373537 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
15 | 32488 | 32724 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
16 | 161660 | 161896 | + | NZ_CP011600.1 | Phytobacter ursingii |
17 | 314363 | 314599 | - | NZ_CP005961.1 | Pseudomonas mandelii JR-1 |
18 | 157744 | 157980 | + | NZ_CP005961.1 | Pseudomonas mandelii JR-1 |
19 | 323108 | 323344 | - | NZ_CP009365.1 | Pseudomonas soli |
20 | 21323 | 21559 | + | NZ_CP027670.1 | Simplicispira suum |
21 | 1854046 | 1854282 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
22 | 68997 | 69233 | - | NZ_CP062807.1 | Cupriavidus basilensis |
23 | 4464 | 4700 | + | NZ_CP032520.1 | Cupriavidus oxalaticus |
24 | 74442 | 74678 | - | NZ_CP032520.1 | Cupriavidus oxalaticus |
25 | 561044 | 561280 | + | NZ_CP032520.1 | Cupriavidus oxalaticus |
26 | 1266359 | 1266595 | - | NC_007953.1 | Paraburkholderia xenovorans LB400 |
27 | 462191 | 462427 | - | NZ_CP059082.1 | Halomonas titanicae |
28 | 2250872 | 2251090 | - | NC_020541.1 | Rhodanobacter denitrificans |
29 | 2009853 | 2010071 | - | NC_020541.1 | Rhodanobacter denitrificans |
30 | 2232719 | 2232937 | + | NC_020541.1 | Rhodanobacter denitrificans |
31 | 5732523 | 5732759 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
32 | 5414429 | 5414665 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02411.17 | 0.9 | 18 | 2837 | same-strand | MerT mercuric transport protein |
2 | PF00403.28 | 1.0 | 20 | 2137 | same-strand | Heavy-metal-associated domain |
3 | PF03203.16 | 0.8 | 16 | 2105 | same-strand | MerC mercury resistance protein |
4 | PF07992.16 | 1.0 | 20 | 380.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
5 | PF02852.24 | 1.0 | 20 | 380.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
6 | PF00070.29 | 1.0 | 20 | 380.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
7 | PF13411.8 | 1.0 | 20 | -3 | same-strand | MerR HTH family regulatory protein |
8 | PF00239.23 | 0.6 | 12 | 903 | same-strand | Resolvase, N terminal domain |
9 | PF11809.10 | 0.7 | 14 | 66 | same-strand | Domain of unknown function (DUF3330) |