| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | BA000018.3 |
| Organism | Staphylococcus aureus (strain N315) |
| Left | 1409674 |
| Right | 1409943 |
| Strand | + |
| Nucleotide Sequence | ATGAGACATATACATTTACAAGTATTCGGACGCGTTCAAGGCGTCGGATTTAGATATTTTACACAACGCATTGCAATGAACTATAACATTGTCGGTACTGTTCAAAATGTAGATGACTATGTAGAGATATATGCACAAGGGGATGACGCAGATATAGAGAGATTTATTCAAGGTGTAATTGAAGGTGCCTCACCAGCATCAAATGTAACAAGCCATCAACTTGAAGAGTTAGAACTAAATCAAAAATTATCGGATTTTCGATCAATATAA |
| Sequence | MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQGVIEGASPASNVTSHQLEELELNQKLSDFRSI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 11418146 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q7A5P1 |
| ORF Length (Amino Acid) | 89 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1346759 | 1347028 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1447328 | 1447597 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1071886 | 1072155 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 4 | 1481091 | 1481360 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 5 | 1583435 | 1583704 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 6 | 1186604 | 1186876 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 7 | 1384067 | 1384336 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 8 | 721106 | 721375 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 9 | 2403959 | 2404231 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 10 | 1543914 | 1544183 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 1291911 | 1292180 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 12 | 1502335 | 1502604 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 13 | 2557865 | 2558134 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 14 | 1429413 | 1429682 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 15 | 1512795 | 1513064 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 16 | 1453111 | 1453380 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 17 | 1887528 | 1887797 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 18 | 1415847 | 1416116 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 19 | 689946 | 690215 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 20 | 360081 | 360350 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 21 | 922437 | 922706 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 22 | 1041279 | 1041548 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 23 | 1865035 | 1865307 | + | NZ_CP027770.1 | Staphylococcus felis |
| 24 | 378163 | 378432 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 25 | 1324804 | 1325073 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 26 | 2140782 | 2141054 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 27 | 1192695 | 1192961 | + | NZ_CP047361.1 | Macrococcus canis |
| 28 | 1294456 | 1294725 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 29 | 1246448 | 1246720 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 30 | 1313932 | 1314198 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 31 | 1515291 | 1515560 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 32 | 521981 | 522247 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 33 | 1818145 | 1818417 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01168.22 | 0.85 | 28 | 2520 | same-strand | Alanine racemase, N-terminal domain |
| 2 | PF00842.23 | 0.76 | 25 | 2482 | same-strand | Alanine racemase, C-terminal domain |
| 3 | PF02784.18 | 0.94 | 31 | 1292 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 4 | PF00278.24 | 0.94 | 31 | 1292 | same-strand | Pyridoxal-dependent decarboxylase, C-terminal sheet domain |
| 5 | PF00313.24 | 0.97 | 32 | 668.5 | opposite-strand | 'Cold-shock' DNA-binding domain |
| 6 | PF10112.11 | 0.97 | 32 | 18.5 | same-strand | 5-bromo-4-chloroindolyl phosphate hydrolysis protein |
| 7 | PF05816.13 | 0.94 | 31 | 668 | same-strand | Toxic anion resistance protein (TelA) |
| 8 | PF05525.15 | 0.91 | 30 | 1939.0 | opposite-strand | Branched-chain amino acid transport protein |
| 9 | PF07728.16 | 0.64 | 21 | 5276 | opposite-strand | AAA domain (dynein-related subfamily) |
| 10 | PF07726.13 | 0.64 | 21 | 5276 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 11 | PF01546.30 | 0.67 | 22 | 3536.0 | same-strand | Peptidase family M20/M25/M40 |