Result : Q7A441
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Molybdopterin synthase sulfur carrier subunit (MPT synthase subunit 1) (Molybdenum cofactor biosynthesis protein D) (Molybdopterin-converting factor small subunit) (Molybdopterin-converting factor subunit 1) (Sulfur carrier protein MoaD) |
| NCBI Accession ID | BA000018.3 |
| Organism | Staphylococcus aureus (strain N315) |
| Left | 2328300 |
| Right | 2328533 |
| Strand | - |
| Nucleotide Sequence | ATGAAGGTACTTTACTTCGCAGAAATTAAAGATATATTACAAAAAGCACAGGAAGATATTGTGCTTGAACAAGCATTGACTGTACAACAATTTGAAGATTTATTGTTTGAACGTTATCCGCAAATCAATAATAAAAAGTTTCAAGTTGCTGTAAATGAGGAATTTGTACAAAAATCAGATTTCATTCAACCTAATGATACTGTTGCATTAATTCCACCGGTTAGTGGAGGTTAA |
| Sequence | MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG |
| Source of smORF | Swiss-Prot |
| Function | Involved in sulfur transfer in the conversion of molybdopterin precursor Z to molybdopterin. |
| Pubmed ID | 11418146 18092812 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q7A441 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2337694 | 2337927 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2293742 | 2293975 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2192306 | 2192539 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 767851 | 768084 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 5 | 1459111 | 1459344 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 6 | 2001203 | 2001436 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 7 | 765667 | 765900 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 8 | 2666426 | 2666659 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 9 | 1805235 | 1805468 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 10 | 735094 | 735327 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 11 | 748440 | 748673 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 12 | 1078404 | 1078637 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 13 | 1488341 | 1488574 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 14 | 688471 | 688704 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 15 | 782469 | 782702 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 16 | 701074 | 701307 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 17 | 593580 | 593813 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 18 | 2228471 | 2228704 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 19 | 229913 | 230146 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 20 | 870803 | 871036 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 21 | 1790363 | 1790596 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 22 | 535206 | 535439 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 23 | 184174 | 184407 | + | NZ_CP047361.1 | Macrococcus canis |
| 24 | 1259063 | 1259296 | + | NZ_CP027770.1 | Staphylococcus felis |
| 25 | 684940 | 685173 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 673314 | 673547 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 27 | 2002513 | 2002746 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 28 | 1928406 | 1928639 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 29 | 1692505 | 1692738 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 30 | 1746451 | 1746684 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 31 | 453047 | 453280 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 32 | 2214291 | 2214524 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01047.24 | 0.75 | 24 | 3495 | opposite-strand | MarR family |
| 2 | PF12802.9 | 0.66 | 21 | 3815 | opposite-strand | MarR family |
| 3 | PF07690.18 | 0.66 | 21 | 2613 | opposite-strand | Major Facilitator Superfamily |
| 4 | PF06463.15 | 1.0 | 32 | 627.0 | same-strand | Molybdenum Cofactor Synthesis C |
| 5 | PF04055.23 | 1.0 | 32 | 627.0 | same-strand | Radical SAM superfamily |
| 6 | PF12804.9 | 0.94 | 30 | 7.0 | same-strand | MobA-like NTP transferase domain |
| 7 | PF02391.19 | 1.0 | 32 | 0.0 | same-strand | MoaE protein |
| 8 | PF03205.16 | 0.97 | 31 | 454 | same-strand | Molybdopterin guanine dinucleotide synthesis protein B |
| 9 | PF03453.19 | 1.0 | 32 | 924.5 | same-strand | MoeA N-terminal region (domain I and II) |
| 10 | PF00994.26 | 1.0 | 32 | 1819.5 | same-strand | Probable molybdopterin binding domain |
| 11 | PF03454.17 | 1.0 | 32 | 924.5 | same-strand | MoeA C-terminal region (domain IV) |
| 12 | PF01967.23 | 1.0 | 32 | 2246.0 | opposite-strand | MoaC family |
++ More..