| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Type VII secretion system extracellular protein A (Ess extracellular protein A) |
| NCBI Accession ID | BA000033.2 |
| Organism | Staphylococcus aureus (strain MW2) |
| Left | 305719 |
| Right | 306012 |
| Strand | + |
| Nucleotide Sequence | ATGGCAATGATTAAGATGAGTCCAGAGGAAATCAGAGCAAAATCGCAATCTTACGGGCAAGGTTCAGACCAAATCCGTCAAATTTTATCTGATTTAACACGTGCACAAGGTGAAATTGCAGCGAACTGGGAAGGTCAAGCTTTCAGCCGTTTCGAAGAGCAATTCCAACAACTTAGTCCTAAAGTAGAAAAATTTGCACAATTATTAGAAGAAATTAAACAACAATTGAATAGCACTGCTGATGCCGTTCAAGAACAAGACCAACAACTTTCTAATAATTTCGGTTTGCAATAA |
| Sequence | MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ |
| Source of smORF | Swiss-Prot |
| Function | Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion (By similarity). Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity (By similarity). {ECO:0000250|UniProtKB:A0A0H2XI99, ECO:0000250|UniProtKB:P0C046}. |
| Pubmed ID | 12044378 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | Q7A1V4 |
| ORF Length (Amino Acid) | 97 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 276305 | 276598 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 275931 | 276224 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 2100193 | 2100486 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 901077 | 901370 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 5 | 120208 | 120501 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 6 | 2375684 | 2375977 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 7 | 1415804 | 1416097 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 8 | 1213780 | 1214073 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 9 | 383390 | 383668 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 10 | 933543 | 933821 | + | NC_011725.1 | Bacillus cereus B4264 |
| 11 | 1986820 | 1987098 | + | NC_011725.1 | Bacillus cereus B4264 |
| 12 | 4140277 | 4140555 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 13 | 884783 | 885061 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 14 | 2020848 | 2021126 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 4201094 | 4201372 | - | NZ_CP040336.1 | Bacillus luti |
| 16 | 3123578 | 3123856 | - | NZ_CP040336.1 | Bacillus luti |
| 17 | 2012273 | 2012551 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 18 | 913666 | 913944 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 19 | 2120507 | 2120797 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 20 | 1327750 | 1328043 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 21 | 1669067 | 1669345 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 22 | 45195 | 45470 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 23 | 113967 | 114242 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 24 | 46448 | 46723 | + | NZ_LT906444.1 | Listeria welshimeri |
| 25 | 60524 | 60799 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 26 | 2717034 | 2717312 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 27 | 1357089 | 1357367 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 28 | 285377 | 285667 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 29 | 59147 | 59434 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 30 | 2553288 | 2553566 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 31 | 2552871 | 2553149 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 32 | 1064501 | 1064779 | + | NZ_CP008876.1 | Terribacillus goriensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08817.12 | 1.0 | 27 | 3888.0 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
| 2 | PF10140.11 | 0.96 | 26 | 4171 | same-strand | WXG100 protein secretion system (Wss), protein YukC |
| 3 | PF01580.20 | 0.74 | 20 | 5284.0 | same-strand | FtsK/SpoIIIE family |
| 4 | PF12538.10 | 0.81 | 22 | 5405.5 | same-strand | DNA transporter |
| 5 | PF13401.8 | 0.74 | 20 | 5293.5 | same-strand | AAA domain |