Protein Information |
Information Type | Description |
---|---|
Protein name | Esterase PE11 (EC 3.1.1.6) (PE family protein PE11) |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 1299822 |
Right | 1300124 |
Strand | - |
Nucleotide Sequence | GTGTCTTTTGTCACCACACGGCCCGATTCGATTGGGGAAACGGCCGCCAACCTCCACGAGATCGGGGTGACGATGAGCGCCCATGATGACGGGGTCACGCCGCTGATCACCAATGTGGAATCCCCCGCCCACGATCTTGTGTCCATCGTGACGTCGATGCTGTTTTCCATGCACGGCGAGCTGTACAAGGCGATCGCGCGCCAGGCCCATGTGATCCACGAGTCATTTGTCCAAACACTTCAGACCAGCAAGACTTCGTATTGGCTCACCGAATTAGCCAACCGCGCGGGCACCTCCACCTAG |
Sequence | MSFVTTRPDSIGETAANLHEIGVTMSAHDDGVTPLITNVESPAHDLVSIVTSMLFSMHGELYKAIARQAHVIHESFVQTLQTSKTSYWLTELANRAGTST |
Source of smORF | Swiss-Prot |
Function | Involved in cell wall lipids remodeling and in virulence (Pubmed:26157429, Pubmed:26902658, Pubmed:28198348). Restricts the biofilm growth and is essential for the optimal intracellular survival of M.tuberculosis (Pubmed:28198348). Shows esterase activity with a preference for short-chain esters, particularly pNP-acetate (C2) and pNP-butyrate (C4) (Pubmed:26902658). Has weaker activity with pNP-octanoate (C8), pNP-laurate (C12) and pNP-myristate (C14) (Pubmed:26902658). Shows weak long-chain triacylglycerol (TAG) hydrolase activity in vitro (Pubmed:16354661). Not necessary for PPE17 stability or for its localization on the mycobacterial surface (Pubmed:23469198). {ECO:0000269|Pubmed:16354661, ECO:0000269|Pubmed:23469198, ECO:0000269|Pubmed:26157429, ECO:0000269|Pubmed:26902658, ECO:0000269|Pubmed:28198348}. |
Pubmed ID | 9634230 16354661 17687113 21969609 23469198 26157429 26902658 28198348 |
Domain | CDD:395748 |
Functional Category | Others |
Uniprot ID | Q79FR5 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1299822 | 1300124 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 1319937 | 1320239 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 2542528 | 2542827 | - | NZ_AP022606.1 | Mycobacterium branderi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02665.16 | 0.67 | 2 | 5676.0 | opposite-strand | Nitrate reductase gamma subunit |
2 | PF00009.29 | 0.67 | 2 | 3768.0 | opposite-strand | Elongation factor Tu GTP binding domain |
3 | PF00679.26 | 0.67 | 2 | 3768.0 | opposite-strand | Elongation factor G C-terminus |
4 | PF03144.27 | 0.67 | 2 | 3768.0 | opposite-strand | Elongation factor Tu domain 2 |
5 | PF01926.25 | 0.67 | 2 | 3768.0 | opposite-strand | 50S ribosome-binding GTPase |
6 | PF00496.24 | 0.67 | 2 | 1763.0 | opposite-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
7 | PF16859.7 | 1.0 | 3 | 1130 | same-strand | Tetracyclin repressor-like, C-terminal domain |
8 | PF00440.25 | 1.0 | 3 | 1090.0 | both-strands | Bacterial regulatory proteins, tetR family |
9 | PF00823.21 | 1.0 | 3 | 18 | same-strand | PPE family |
10 | PF12484.10 | 1.0 | 3 | 18 | same-strand | PPE-SVP subfamily C-terminal region |
11 | PF02585.19 | 1.0 | 3 | 180 | opposite-strand | GlcNAc-PI de-N-acetylase |
12 | PF00934.22 | 0.67 | 2 | 1631.0 | same-strand | PE family |
13 | PF04055.23 | 0.67 | 2 | 2948.0 | opposite-strand | Radical SAM superfamily |