Result : Q74IP1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein (ACP) |
| NCBI Accession ID | AE017198.1 |
| Organism | Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) |
| Left | 1402007 |
| Right | 1402249 |
| Strand | - |
| Nucleotide Sequence | ATGACCGAAGAGGAAATTTTTAATAAAATTGCTGATATGATTTCAGAACGCTTTAGTATTGATCGTGATAAGATCACTAAAGATTTAAATTTTCAGAATGATTTAGATGCAGATTCAATTGATTTCGTTGAGTTAGTAATGGATCTAGAAGATACATTTGGAGCAGAGATTCCAGATGATGATGCGGAAAAATTACAAACTGTTGGTGAAGCAGTAGAATATATTAAGAGTCACCAAAATTAA |
| Sequence | MTEEEIFNKIADMISERFSIDRDKITKDLNFQNDLDADSIDFVELVMDLEDTFGAEIPDDDAEKLQTVGEAVEYIKSHQN |
| Source of smORF | Swiss-Prot |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01217}. |
| Pubmed ID | 14983040 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q74IP1 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 236
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 732699 | 732941 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 2 | 751572 | 751814 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 3 | 745379 | 745621 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 4 | 811873 | 812115 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 5 | 2892956 | 2893198 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 6 | 1044235 | 1044477 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 7 | 1287348 | 1287590 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 8 | 1070654 | 1070896 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 9 | 866466 | 866708 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 10 | 2937749 | 2938000 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 11 | 2106717 | 2106959 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 12 | 746862 | 747101 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 13 | 2361901 | 2362143 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 14 | 1285927 | 1286178 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 15 | 1751809 | 1752054 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 16 | 1088741 | 1088986 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 17 | 1705858 | 1706103 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 18 | 2119964 | 2120215 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 19 | 528679 | 528921 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 20 | 1828951 | 1829190 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 21 | 662394 | 662636 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 22 | 1088871 | 1089122 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 23 | 1510390 | 1510632 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 24 | 1134071 | 1134313 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 25 | 660001 | 660243 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 26 | 1550995 | 1551237 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 27 | 1014065 | 1014307 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 28 | 871156 | 871398 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 29 | 1189767 | 1190009 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 30 | 979559 | 979801 | - | NZ_CP029476.1 | Lactobacillus apis |
| 31 | 1546963 | 1547205 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 32 | 1705397 | 1705636 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 33 | 725820 | 726068 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 34 | 1361889 | 1362131 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 35 | 1111944 | 1112186 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 36 | 1898054 | 1898302 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 37 | 887682 | 887924 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 38 | 1569104 | 1569346 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 39 | 1498273 | 1498515 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 40 | 1514596 | 1514838 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 41 | 738098 | 738346 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 42 | 230966 | 231208 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 43 | 1031603 | 1031848 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 44 | 1989769 | 1990008 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 45 | 1081680 | 1081883 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 46 | 1252183 | 1252437 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 47 | 886624 | 886866 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 48 | 420359 | 420601 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 49 | 126187 | 126432 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 50 | 847406 | 847648 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 51 | 1251180 | 1251428 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 52 | 1143042 | 1143248 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 53 | 1032297 | 1032551 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 54 | 1197478 | 1197720 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 55 | 496978 | 497220 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 56 | 1217409 | 1217651 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 57 | 846763 | 847005 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 58 | 1726560 | 1726802 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 59 | 92950 | 93192 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 60 | 96083 | 96325 | + | NZ_CP065211.1 | Enterococcus lactis |
| 61 | 1050787 | 1051029 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 62 | 1969999 | 1970238 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 63 | 555144 | 555386 | - | NZ_CP023011.2 | Enterococcus hirae |
| 64 | 93169 | 93411 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 65 | 1196286 | 1196531 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 66 | 3183964 | 3184206 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 67 | 1230591 | 1230836 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 68 | 620731 | 620946 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 69 | 1249053 | 1249298 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 70 | 1189394 | 1189636 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 71 | 2472078 | 2472317 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 72 | 999836 | 1000069 | + | NZ_CP047361.1 | Macrococcus canis |
| 73 | 533774 | 534016 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 74 | 1071373 | 1071615 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 75 | 392905 | 393147 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 76 | 5130667 | 5130864 | + | NZ_CP063458.1 | Humisphaera borealis |
| 77 | 720775 | 721008 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 78 | 1673667 | 1673900 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 79 | 1697186 | 1697419 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 80 | 1472328 | 1472561 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 81 | 101019 | 101252 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 82 | 1613225 | 1613458 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 83 | 532888 | 533121 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 84 | 182838 | 183071 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 85 | 882239 | 882472 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 86 | 2367759 | 2367992 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 87 | 570976 | 571209 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 88 | 1735416 | 1735649 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 89 | 1409906 | 1410148 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 90 | 2407814 | 2408056 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 91 | 2581846 | 2582097 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 92 | 1056418 | 1056654 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 93 | 628280 | 628516 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 94 | 1196199 | 1196435 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 95 | 1704045 | 1704278 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 96 | 2383193 | 2383435 | - | NZ_CP038452.1 | Thermus caldilimi |
| 97 | 1494907 | 1495143 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 98 | 1606055 | 1606291 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 99 | 1710376 | 1710612 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 100 | 1249445 | 1249681 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 101 | 862015 | 862248 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 102 | 1698805 | 1699038 | + | NZ_CP027770.1 | Staphylococcus felis |
| 103 | 988759 | 988992 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 104 | 737802 | 738041 | + | NZ_CP027563.1 | Weissella confusa |
| 105 | 2212186 | 2212419 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 106 | 1405709 | 1405951 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 107 | 1222182 | 1222415 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 108 | 1151545 | 1151778 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 109 | 1297406 | 1297639 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 110 | 5571221 | 5571466 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 111 | 1715747 | 1715980 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 112 | 1406405 | 1406650 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 113 | 1457786 | 1457986 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 114 | 3756264 | 3756515 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 115 | 2113932 | 2114174 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 116 | 1636947 | 1637180 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 117 | 1177512 | 1177745 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 118 | 1800349 | 1800549 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 119 | 1094548 | 1094781 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 120 | 2287829 | 2288068 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 121 | 378909 | 379148 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 122 | 2073887 | 2074129 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 123 | 1620275 | 1620508 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 124 | 1073385 | 1073618 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 125 | 1785066 | 1785299 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 126 | 359006 | 359206 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 127 | 986692 | 986946 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 128 | 169317 | 169556 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 129 | 1763977 | 1764213 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 130 | 2843272 | 2843493 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 131 | 1692174 | 1692386 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 132 | 1145768 | 1146010 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 133 | 1622599 | 1622841 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 134 | 1439090 | 1439332 | - | NZ_CP016312.1 | Thermus brockianus |
| 135 | 630973 | 631212 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 136 | 849950 | 850183 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 137 | 927890 | 928123 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 138 | 393666 | 393908 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 139 | 1582629 | 1582871 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 140 | 968625 | 968873 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 141 | 2804615 | 2804809 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 142 | 2536263 | 2536496 | - | NZ_CP028842.1 | Clostridium botulinum |
| 143 | 453133 | 453366 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 144 | 1397433 | 1397648 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 145 | 2798633 | 2798866 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 146 | 1931693 | 1931944 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 147 | 380372 | 380614 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 148 | 1570512 | 1570745 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 149 | 1469542 | 1469775 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 150 | 1549173 | 1549406 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 151 | 683063 | 683296 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 152 | 6395849 | 6396070 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 153 | 258748 | 258960 | + | NZ_CP010904.1 | Kiritimatiella glycovorans |
| 154 | 402073 | 402327 | + | NZ_CP014324.1 | Oenococcus oeni |
| 155 | 1697243 | 1697473 | - | NZ_CP014204.2 | Clostridium baratii |
| 156 | 2281161 | 2281394 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 157 | 1176724 | 1176954 | + | NZ_CP020953.1 | Clostridium drakei |
| 158 | 137998 | 138228 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 159 | 3091256 | 3091486 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 160 | 593526 | 593777 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 161 | 1264444 | 1264674 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 162 | 2834604 | 2834837 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 163 | 617187 | 617429 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 164 | 3616625 | 3616858 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 165 | 1380569 | 1380802 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 166 | 1569307 | 1569519 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 167 | 1447115 | 1447357 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 168 | 1567881 | 1568117 | + | NZ_CP060052.1 | Croceicoccus marinus |
| 169 | 660704 | 660946 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 170 | 896308 | 896538 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 171 | 1815974 | 1816207 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 172 | 1328300 | 1328527 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 173 | 1320224 | 1320451 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 174 | 1306501 | 1306728 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 175 | 1683241 | 1683441 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 176 | 6024354 | 6024605 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 177 | 1148643 | 1148879 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 178 | 1268757 | 1268990 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 179 | 2167847 | 2168044 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 180 | 1044664 | 1044912 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 181 | 6882031 | 6882246 | + | NZ_CP053452.2 | Frigoriglobus tundricola |
| 182 | 5865330 | 5865584 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 183 | 1318148 | 1318375 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 184 | 1429967 | 1430194 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 185 | 3104160 | 3104390 | - | NZ_CP014176.1 | Clostridium argentinense |
| 186 | 2590321 | 2590542 | + | NZ_CP026363.1 | Brevibacillus agri |
| 187 | 2379016 | 2379237 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 188 | 627720 | 627944 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 189 | 1184156 | 1184389 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 190 | 812453 | 812686 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 191 | 2101078 | 2101311 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 192 | 1747111 | 1747353 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 193 | 1416164 | 1416394 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 194 | 1493061 | 1493291 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 195 | 1493347 | 1493577 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 196 | 2914500 | 2914730 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 197 | 2429768 | 2430001 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 198 | 1203773 | 1204003 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 199 | 1443892 | 1444107 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 200 | 930972 | 931187 | + | NZ_LR593886.1 | Gemmata massiliana |
| 201 | 1178011 | 1178238 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 202 | 3137887 | 3138102 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 203 | 1690426 | 1690659 | + | NZ_LT828648.1 | Nitrospira japonica |
| 204 | 4332064 | 4332297 | - | NZ_AP019400.1 | Cohnella abietis |
| 205 | 1520912 | 1521136 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 206 | 855377 | 855610 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 207 | 1081044 | 1081244 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 208 | 1957737 | 1957976 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 209 | 1495910 | 1496143 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 210 | 1433783 | 1433977 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 211 | 674978 | 675175 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 212 | 1731864 | 1732097 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 213 | 1413052 | 1413288 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 214 | 2679371 | 2679604 | - | NZ_LS483476.1 | Lederbergia lentus |
| 215 | 2490934 | 2491158 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 216 | 2985932 | 2986162 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 217 | 4782652 | 4782888 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 218 | 1685473 | 1685706 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 219 | 4842603 | 4842839 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 220 | 2874086 | 2874322 | + | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 221 | 5452872 | 5453108 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 222 | 6497984 | 6498220 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 223 | 5270702 | 5270938 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 224 | 2141761 | 2141997 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 225 | 5349178 | 5349414 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 226 | 2060005 | 2060259 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 227 | 988590 | 988817 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 228 | 2698565 | 2698798 | - | NZ_CP034588.1 | Silicimonas algicola |
| 229 | 1061802 | 1062029 | - | NZ_CP036291.1 | Pirellulimonas nuda |
| 230 | 423646 | 423843 | + | NZ_CP036292.1 | Rosistilla oblonga |
| 231 | 5655237 | 5655464 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 232 | 158949 | 159173 | + | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 233 | 7596995 | 7597189 | + | NZ_CP036298.1 | Aureliella helgolandensis |
| 234 | 325746 | 325940 | + | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 235 | 452158 | 452352 | - | NZ_CP036274.1 | Anatilimnocola aggregata |
| 236 | 5863274 | 5863513 | - | NZ_CP042912.1 | Mariniblastus fucicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014912.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02504.17 | 0.82 | 194 | 145.5 | same-strand | Fatty acid synthesis protein |
| 2 | PF14622.8 | 0.61 | 145 | 154 | same-strand | Ribonuclease-III-like |
| 3 | PF00636.28 | 0.61 | 145 | 154 | same-strand | Ribonuclease III domain |
| 4 | PF00035.28 | 0.61 | 145 | 154 | same-strand | Double-stranded RNA binding motif |
++ More..