Result : Q74I51
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AE017198.1 |
| Organism | Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) |
| Left | 1602115 |
| Right | 1602417 |
| Strand | - |
| Nucleotide Sequence | GTGAAAATTACAAAAGATGAAATCAATCACGTTGCAGCACTATCTCGACTTGAGTTTGGTGAAGACGAAATTGATAAGTTTACTGAACAAATGGGTGACATTATCAATATGGCACATCAATTAGCCGAAGTTGATACTGAAGGAGTTCCTGAAACTGTTCAAGTTGTTGATCGAGAGACTGACTTTAGAGAAGACAAGCCTGAACATTGGGAAAGTCGCGCAGAATTAATGAAGAATGTTCCTGAAAAAGCTGATGGCTTCATTAAGGTGCCAGTAATTATTGATAAGGATGATAATGAATAA |
| Sequence | MKITKDEINHVAALSRLEFGEDEIDKFTEQMGDIINMAHQLAEVDTEGVPETVQVVDRETDFREDKPEHWESRAELMKNVPEKADGFIKVPVIIDKDDNE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 14983040 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q74I51 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1543080 | 1543382 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 2 | 1509913 | 1510215 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 3 | 1505189 | 1505491 | - | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 4 | 1067618 | 1067926 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 5 | 432713 | 433015 | + | NZ_CP029476.1 | Lactobacillus apis |
| 6 | 1325866 | 1326168 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 7 | 292604 | 292912 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 8 | 520804 | 521112 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 9 | 1662457 | 1662765 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 10 | 1737905 | 1738213 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 11 | 527943 | 528245 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 12 | 1476853 | 1477155 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 13 | 400220 | 400525 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 14 | 543835 | 544137 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 15 | 1252848 | 1253123 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 16 | 334609 | 334911 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 17 | 2399276 | 2399581 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 18 | 1183901 | 1184206 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 19 | 1113430 | 1113735 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 20 | 1611744 | 1612049 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 21 | 1096575 | 1096880 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 22 | 1174029 | 1174334 | + | NZ_CP065211.1 | Enterococcus lactis |
| 23 | 1817540 | 1817845 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 24 | 1857281 | 1857586 | + | NZ_CP023011.2 | Enterococcus hirae |
| 25 | 1356707 | 1357006 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 26 | 1428715 | 1429020 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 27 | 151945 | 152208 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 28 | 1615540 | 1615845 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 29 | 3781325 | 3781630 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 30 | 344169 | 344432 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 31 | 3880814 | 3881104 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 32 | 1363567 | 1363869 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018549.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00781.26 | 0.91 | 29 | 2909 | same-strand | Diacylglycerol kinase catalytic domain |
| 2 | PF19279.1 | 0.88 | 28 | 2909.0 | same-strand | YegS C-terminal NAD kinase beta sandwich-like domain |
| 3 | PF02934.17 | 1.0 | 32 | 1466.5 | same-strand | GatB/GatE catalytic domain |
| 4 | PF02637.20 | 1.0 | 32 | 1466.5 | same-strand | GatB domain |
| 5 | PF01425.23 | 1.0 | 32 | 0.0 | same-strand | Amidase |
| 6 | PF07537.13 | 0.66 | 21 | 14 | same-strand | CamS sex pheromone cAM373 precursor |
| 7 | PF01653.20 | 0.91 | 29 | 1166 | same-strand | NAD-dependent DNA ligase adenylation domain |
| 8 | PF03120.18 | 0.91 | 29 | 1166 | same-strand | NAD-dependent DNA ligase OB-fold domain |
| 9 | PF12826.9 | 0.91 | 29 | 1166 | same-strand | Helix-hairpin-helix motif |
| 10 | PF00533.28 | 0.91 | 29 | 1166 | same-strand | BRCA1 C Terminus (BRCT) domain |
| 11 | PF03119.18 | 0.91 | 29 | 1166 | same-strand | NAD-dependent DNA ligase C4 zinc finger domain |
| 12 | PF13361.8 | 0.91 | 29 | 3214 | same-strand | UvrD-like helicase C-terminal domain |
| 13 | PF00580.23 | 0.91 | 29 | 3214 | same-strand | UvrD/REP helicase N-terminal domain |
| 14 | PF13245.8 | 0.91 | 29 | 3214 | same-strand | AAA domain |
| 15 | PF13538.8 | 0.84 | 27 | 3214 | same-strand | UvrD-like helicase C-terminal domain |
++ More..