Result : Q748G1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AE017180.2 |
| Organism | Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) |
| Left | 3346276 |
| Right | 3346515 |
| Strand | - |
| Nucleotide Sequence | ATGTTAGTACTGACCAGAAAAATGGGAGAAGTAGTCACCATCGGCGATTCCATCAGGATCAAGGTGGTGGAGATGAAAGGAAACCAAGTGCGGCTCGGCATCGAGGCTCCCAACGACATGCGCATCTACCGTGAGGAAATCTATATCAAGGTTCAGCGCGAAAACCAGATTGCCGCTTCGTGGAGCCTGGCGGACCTGGAGAAGGCGGTAACCTGCCTCGGCGCGGACGGGAAGGAGTAA |
| Sequence | MLVLTRKMGEVVTIGDSIRIKVVEMKGNQVRLGIEAPNDMRIYREEIYIKVQRENQIAASWSLADLEKAVTCLGADGKE |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 14671304 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q748G1 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3346276 | 3346515 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 2 | 539760 | 539999 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 3 | 485123 | 485359 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 4 | 4754514 | 4754753 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 5 | 4168811 | 4169050 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 6 | 1221863 | 1222105 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 7 | 2564767 | 2565012 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 8 | 1345723 | 1345962 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 9 | 3052267 | 3052503 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 10 | 3178197 | 3178436 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 11 | 617514 | 617726 | - | NZ_CP042218.1 | Luteimonas granuli |
| 12 | 2008259 | 2008504 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 13 | 3344894 | 3345121 | + | NC_016620.1 | Halobacteriovorax marinus SJ |
| 14 | 600772 | 601008 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 15 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 16 | 439987 | 440214 | + | NZ_CP012024.1 | Bacillus smithii |
| 17 | 1887630 | 1887824 | - | NZ_LT906451.1 | Legionella lansingensis |
| 18 | 894510 | 894704 | - | NZ_LR134374.1 | Legionella spiritensis |
| 19 | 926283 | 926525 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 20 | 1162581 | 1162775 | + | NZ_LT906442.1 | Legionella waltersii |
| 21 | 883966 | 884163 | + | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 22 | 24158 | 24391 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 23 | 2035990 | 2036235 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 24 | 1265487 | 1265696 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 25 | 3154882 | 3155130 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 26 | 431457 | 431708 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 27 | 2273478 | 2273708 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 28 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 29 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
| 30 | 3436208 | 3436435 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 31 | 581138 | 581365 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 32 | 1150025 | 1150255 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 33 | 2370805 | 2371041 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 34 | 483501 | 483731 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 35 | 1158804 | 1159037 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002939.5
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00669.22 | 0.74 | 26 | 574.0 | same-strand | Bacterial flagellin N-terminal helical region |
| 2 | PF00700.23 | 0.69 | 24 | 689.5 | same-strand | Bacterial flagellin C-terminal helical region |
| 3 | PF02623.17 | 0.77 | 27 | 5 | same-strand | FliW protein |
++ More..