Result : A8ZSH8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative regulatory protein Dole_1911 |
| NCBI Accession ID | CP000859.1 |
| Organism | Desulfococcus oleovorans (strain DSM 6200 / Hxd3) |
| Left | 2313755 |
| Right | 2314048 |
| Strand | - |
| Nucleotide Sequence | ATGCACCGAAAAAACCTATTAAATATAGGGTTTGGCAATCGTATTGTAGCCGAAGACATCATTGCCGTTGTTTCACCGGCATCGGCGCCGGTCAAACGGATGAAGGACGAGGCCAAAAAGGCCGGCCGGCTGGTGGACGCCACCCAGGGCCGGAAAACCCGGTCTGTGATCGTGATGGCCAGTAATCACGTTATTCTCTCCGCCATTCATACGGAGACCATTTCTCAACGGTTTGCCGCCATCAACGGCAACCGGCTCGGACCGGATGATGATCCGGACCTGATGCCCGAATAG |
| Sequence | MHRKNLLNIGFGNRIVAEDIIAVVSPASAPVKRMKDEAKKAGRLVDATQGRKTRSVIVMASNHVILSAIHTETISQRFAAINGNRLGPDDDPDLMPE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00898. Profile Description: Domain of unknown function (DUF370). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412637 |
| Functional Category | Others |
| Uniprot ID | A8ZSH8 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 92
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2313755 | 2314048 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 2 | 2512789 | 2513058 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 3 | 2721810 | 2722064 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 4 | 3283406 | 3283663 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 5 | 2362422 | 2362685 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 6 | 85999 | 86256 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 7 | 8251558 | 8251800 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 8 | 2776685 | 2776942 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 9 | 164103 | 164339 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 10 | 1171445 | 1171726 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 11 | 2516657 | 2516911 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 12 | 3746442 | 3746696 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 13 | 364827 | 365093 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 14 | 464792 | 465049 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 15 | 3114868 | 3115128 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 16 | 2551137 | 2551391 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 17 | 4167659 | 4167922 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 18 | 4066390 | 4066644 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 19 | 903850 | 904104 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 20 | 912487 | 912750 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 21 | 390350 | 390607 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 22 | 996736 | 996990 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 23 | 986614 | 986895 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 24 | 4442056 | 4442340 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 25 | 1070337 | 1070591 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 26 | 2385976 | 2386230 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 27 | 3117834 | 3118070 | - | NZ_CP039126.1 | Blautia producta |
| 28 | 78203 | 78439 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 29 | 2267251 | 2267496 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 30 | 2797262 | 2797537 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 31 | 3150536 | 3150802 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 32 | 3337229 | 3337492 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 33 | 4128806 | 4129069 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 34 | 2422768 | 2423049 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 35 | 2354086 | 2354358 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 36 | 5543729 | 5543974 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 37 | 1795159 | 1795434 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 38 | 1345526 | 1345798 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 39 | 2807468 | 2807749 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 40 | 2274849 | 2275106 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 41 | 2700808 | 2701053 | - | NZ_LS483476.1 | Lederbergia lentus |
| 42 | 2488053 | 2488328 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 43 | 1400099 | 1400347 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 44 | 2341814 | 2342086 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 45 | 2604584 | 2604847 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 46 | 592555 | 592803 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 47 | 1353765 | 1354043 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 48 | 3588464 | 3588739 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 49 | 1352408 | 1352683 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 50 | 1463491 | 1463727 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 51 | 971655 | 971903 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 52 | 1351799 | 1352035 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 53 | 1361933 | 1362220 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 54 | 1341887 | 1342174 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 55 | 2107469 | 2107705 | - | NZ_CP030280.1 | Blautia argi |
| 56 | 3719925 | 3720182 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 57 | 986894 | 987142 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 58 | 2942030 | 2942290 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 59 | 1765907 | 1766167 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 60 | 1581410 | 1581658 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 61 | 1667040 | 1667300 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 62 | 4454210 | 4454470 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 63 | 4840861 | 4841121 | - | NZ_CP034437.1 | Paenibacillus albus |
| 64 | 2453298 | 2453558 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 65 | 2243700 | 2243960 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 66 | 2866401 | 2866661 | + | NZ_CP009288.1 | Paenibacillus durus |
| 67 | 1331000 | 1331260 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 68 | 1603487 | 1603747 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 69 | 5055133 | 5055393 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 70 | 3125730 | 3125990 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 71 | 3493419 | 3493679 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 72 | 3602085 | 3602345 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 73 | 2608673 | 2608933 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 74 | 2813692 | 2813952 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 75 | 6076671 | 6076931 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 76 | 6440324 | 6440584 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 77 | 4870032 | 4870280 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 78 | 4273908 | 4274168 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 79 | 1193022 | 1193282 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 80 | 4345479 | 4345739 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 81 | 3535512 | 3535772 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 82 | 1116184 | 1116444 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 83 | 719184 | 719444 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 84 | 2302032 | 2302292 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 85 | 98382 | 98630 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 86 | 476944 | 477204 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 87 | 2147577 | 2147825 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 88 | 5301570 | 5301818 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 89 | 2248346 | 2248609 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 90 | 1016057 | 1016329 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 91 | 6447290 | 6447550 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 92 | 4121566 | 4121826 | - | NZ_CP013023.1 | Paenibacillus bovis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029462.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.97 | 89 | 10 | same-strand | Guanylate kinase |
| 2 | PF13238.8 | 0.71 | 65 | 14 | same-strand | AAA domain |
| 3 | PF03755.15 | 0.86 | 79 | 47 | same-strand | YicC-like family, N-terminal region |
| 4 | PF08340.13 | 0.86 | 79 | 47 | same-strand | Domain of unknown function (DUF1732) |
| 5 | PF01192.24 | 0.68 | 63 | 639 | same-strand | RNA polymerase Rpb6 |
| 6 | PF04127.17 | 0.64 | 59 | 972 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.64 | 59 | 972 | same-strand | Flavoprotein |
++ More..