Result : A0LHS2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP000478.1 |
| Organism | Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) |
| Left | 1581583 |
| Right | 1581861 |
| Strand | + |
| Nucleotide Sequence | ATGCTGAAAGCAATCCGGAGGTTCTTTGGGGAAAAGGCTAGCGGTCAGGTCGCCCGCCGACGCATGCAGGTGGTTCTCATGCACGACCGGATGGACCTGACACCCGATATCATGGAAGCACTGCGCAATGATATCCTGGCGGTGATTTCGAGGTACATGGAAATCGACAGCCGGAGCATCCGGGTGGACCTCGAGCAGGGCAAGGAATATATGGCTCTCGTTTCAAACATCCAAATAAAGCGCGTCTACCGGAAGGCCGCCCCTGACATTCGATCCTAG |
| Sequence | MLKAIRRFFGEKASGQVARRRMQVVLMHDRMDLTPDIMEALRNDILAVISRYMEIDSRSIRVDLEQGKEYMALVSNIQIKRVYRKAAPDIRS |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | A0LHS2 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1581583 | 1581861 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 2 | 1259623 | 1259895 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008554.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13336.8 | 1.0 | 2 | 2342.0 | same-strand | Acetyl-CoA hydrolase/transferase C-terminal domain |
| 2 | PF06941.14 | 1.0 | 2 | 1706.0 | same-strand | 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C) |
| 3 | PF03775.18 | 1.0 | 2 | 869.0 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 4 | PF01656.25 | 1.0 | 2 | 16.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF13614.8 | 1.0 | 2 | 16.0 | same-strand | AAA domain |
| 6 | PF10609.11 | 1.0 | 2 | 16.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 7 | PF14451.8 | 1.0 | 2 | 158.0 | same-strand | Mut7-C ubiquitin |
| 8 | PF02597.22 | 1.0 | 2 | 158.0 | same-strand | ThiS family |
++ More..