Protein Information |
Information Type | Description |
---|---|
Protein name | CRISPR-associated endonuclease Cas2 2 (EC 3.1.-.-) |
NCBI Accession ID | AE017222.1 |
Organism | Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) |
Left | 92454 |
Right | 92726 |
Strand | + |
Nucleotide Sequence | ATGGGAAAGCGTCTCTATGCCGTGGCGTACGACATTCCGGACGACACTCGCCGGGTGAAGCTGGCCAACCTCCTGAAAAGCTACGGGGAGCGGGTCCAGCTCTCCGTGTTTGAGTGCTACCTGGACGAGCGGCTTCTGGAGGACCTGCGGCGGAGGGCCAGGCGGCTTTTGGACCTGGGCCAGGACGCCTTGCGCATCTACCCCGTGGCGGGCCAGGTGGAGGTTCTGGGCGTGGGGCCTTTGCCGGAGCTCCGGGAGGTCCAGGTGCTGTGA |
Sequence | MGKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPELREVQVL |
Source of smORF | Swiss-Prot |
Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Functions as a dsDNA endonuclease and as a weak ssRNase (Pubmed:22942283). {ECO:0000255|HAMAP-Rule:MF_01471, ECO:0000269|Pubmed:22942283}. |
Pubmed ID | 15064768 22942283 |
Domain | CDD:416272 |
Functional Category | Metal-binding |
Uniprot ID | Q746F4 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 136129 | 136401 | + | NC_006462.1 | Thermus thermophilus HB8 |
2 | 81388 | 81660 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
3 | 780266 | 780538 | - | NC_019386.1 | Thermus oshimai JL-2 |
4 | 31940 | 32212 | - | NZ_CP016313.1 | Thermus brockianus |
5 | 192609 | 192872 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
6 | 471667 | 471936 | - | NC_014221.1 | Truepera radiovictrix DSM 17093 |
7 | 697660 | 697935 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
8 | 26010 | 26285 | - | NC_019773.1 | Anabaena cylindrica PCC 7122 |
9 | 2543682 | 2543963 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09670.12 | 0.67 | 6 | 1817 | same-strand | CRISPR-associated protein (Cas Cas02710) |
2 | PF01867.18 | 0.78 | 7 | 21 | same-strand | CRISPR associated protein Cas1 |