Result : Q73ZP6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein MbtL (ACP) (Mycobactin synthase protein L) |
| NCBI Accession ID | AE016958.1 |
| Organism | Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis) |
| Left | 1709151 |
| Right | 1709420 |
| Strand | - |
| Nucleotide Sequence | ATGCCCGCGGGCTCACCCGAAAACCACGTCAGCGCCGAGCTTCTCGGCATCCTGCGCGACGACCTCAACGTCGACGTGTCCCGGGTGACTCCGGACGCCCGGCTGGTCGACGACGTCGGGCTGGACTCGGTGGCGTTCGCGGTGGGCATGGTGGCCATCGAGGAACGGCTCGGGGTCACGCTGACCGAAGAGGAACTGCTGAGCTGCGAGACCGTCGGCGACCTGCAGGCCGCGATCGCCGCGGAACCCCGCGAAACCCGCGATGAGTGA |
| Sequence | MPAGSPENHVSAELLGILRDDLNVDVSRVTPDARLVDDVGLDSVAFAVGMVAIEERLGVTLTEEELLSCETVGDLQAAIAAEPRETRDE |
| Source of smORF | Swiss-Prot |
| Function | Acyl carrier protein involved in the formation of acyl-S-ACP intermediates within the mycobactin biosynthesis process. {ECO:0000250}. |
| Pubmed ID | 16116077 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q73ZP6 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2478869 | 2479174 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 2 | 30420 | 30683 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 3 | 2816019 | 2816273 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 4 | 30036 | 30254 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 5 | 2695817 | 2696071 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 6 | 29992 | 30255 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 7 | 2599536 | 2599790 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 8 | 26306 | 26563 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 9 | 4527387 | 4527641 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 10 | 4242648 | 4242881 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 11 | 1509034 | 1509288 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 12 | 1533733 | 1533987 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 13 | 1527505 | 1527765 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 14 | 5255764 | 5255991 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 15 | 826122 | 826391 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 16 | 1043683 | 1043943 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 17 | 1659105 | 1659365 | + | NC_015576.1 | Mycolicibacter sinensis |
| 18 | 380792 | 381052 | - | NZ_AP022562.1 | Mycobacterium novum |
| 19 | 5560168 | 5560446 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 20 | 1484547 | 1484768 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 21 | 1868460 | 1868744 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 22 | 5595500 | 5595769 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 23 | 5183094 | 5183327 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 24 | 2280570 | 2280839 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 25 | 1547748 | 1548008 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 26 | 3396597 | 3396863 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 27 | 591820 | 592089 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 28 | 2709244 | 2709513 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 29 | 2157778 | 2158047 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 30 | 4187490 | 4187753 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 31 | 3434708 | 3434968 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 32 | 3421009 | 3421269 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 33 | 3344251 | 3344511 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 34 | 1847568 | 1847837 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 35 | 6104577 | 6104846 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 36 | 3885022 | 3885282 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 37 | 1900983 | 1901243 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 38 | 2016124 | 2016393 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 39 | 5057608 | 5057853 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 40 | 3083439 | 3083708 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 41 | 4659535 | 4659780 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 42 | 3122461 | 3122730 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 43 | 377949 | 378194 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 44 | 2356459 | 2356683 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 45 | 3871676 | 3871894 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 46 | 20623 | 20841 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 47 | 1614177 | 1614425 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 48 | 456979 | 457227 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 49 | 4192671 | 4192907 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 50 | 3837963 | 3838244 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009360.4
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 0.98 | 44 | -3 | same-strand | AMP-binding enzyme |
| 2 | PF14535.8 | 0.91 | 41 | -3 | same-strand | AMP-binding enzyme C-terminal domain |
| 3 | PF00441.26 | 0.93 | 42 | 1571 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 4 | PF02770.21 | 0.93 | 42 | 1571 | same-strand | Acyl-CoA dehydrogenase, middle domain |
| 5 | PF08028.13 | 0.62 | 28 | 1574.0 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 6 | PF02771.18 | 0.8 | 36 | 1574.0 | same-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 7 | PF13523.8 | 0.96 | 43 | 2738 | opposite-strand | Acetyltransferase (GNAT) domain |
++ More..