Result : Q73PL4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | AE017226.1 |
| Organism | Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) |
| Left | 814557 |
| Right | 814742 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAGAGAATTAGTGTAAAATTAGTAAAAAGTACAATCGGTCAAAAGCAGCCGGTTTGTTCGACTATCCGCTCTTTGGGATTAAAAAAGCTTAATTCCACAGTTGAGCATGATGCAAATCCTGCCGTATTAGGTATGGTAAAACGCGTTGCTCACTTGGTTGAAGTTAAGGAGTTAAACTAA |
| Sequence | MAKRISVKLVKSTIGQKQPVCSTIRSLGLKKLNSTVEHDANPAVLGMVKRVAHLVEVKELN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 15064399 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q73PL4 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 144
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 814557 | 814742 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 2 | 2711903 | 2712088 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 3 | 484659 | 484844 | - | NZ_CP009228.1 | Treponema putidum |
| 4 | 2692213 | 2692398 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 5 | 211649 | 211834 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 6 | 2360532 | 2360717 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 7 | 545718 | 545903 | + | NZ_CP031518.1 | Treponema ruminis |
| 8 | 2502184 | 2502369 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 9 | 447640 | 447825 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 10 | 4058543 | 4058725 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 11 | 129483 | 129665 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 12 | 135128 | 135310 | + | NC_011725.1 | Bacillus cereus B4264 |
| 13 | 128127 | 128315 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 14 | 136607 | 136789 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 15 | 7056697 | 7056891 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 16 | 4984506 | 4984688 | - | NZ_CP040336.1 | Bacillus luti |
| 17 | 134926 | 135108 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 18 | 2805394 | 2805579 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 19 | 154838 | 155020 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 20 | 44229 | 44417 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 21 | 135792 | 135974 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 22 | 2983075 | 2983257 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 23 | 2121905 | 2122087 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 24 | 1084251 | 1084448 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 25 | 2605546 | 2605728 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 26 | 438666 | 438848 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 27 | 378480 | 378635 | - | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 28 | 2859975 | 2860130 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 29 | 2544095 | 2544274 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 30 | 257277 | 257459 | - | NZ_CP029186.1 | Flavobacterium album |
| 31 | 150178 | 150360 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 32 | 4395107 | 4395292 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 33 | 1980258 | 1980437 | + | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 34 | 1935407 | 1935562 | + | NZ_CP013909.1 | Hymenobacter sedentarius |
| 35 | 340756 | 340938 | + | NZ_LN879430.1 | Herbinix luporum |
| 36 | 147183 | 147365 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 37 | 3335970 | 3336152 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 38 | 170312 | 170494 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 39 | 147811 | 147993 | + | NZ_CP016538.2 | Planococcus maritimus |
| 40 | 147652 | 147834 | + | NZ_CP059540.1 | Planococcus maritimus |
| 41 | 3587659 | 3587841 | + | NZ_CP017477.1 | Polaribacter vadi |
| 42 | 1837807 | 1837983 | - | NZ_CP034159.1 | Kaistella carnis |
| 43 | 3266622 | 3266804 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 44 | 3985377 | 3985565 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 45 | 4176086 | 4176265 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 46 | 335282 | 335464 | - | NZ_CP019419.1 | Polaribacter reichenbachii |
| 47 | 5290675 | 5290860 | - | NZ_CP009288.1 | Paenibacillus durus |
| 48 | 1926041 | 1926223 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 49 | 138150 | 138332 | + | NZ_CP016540.2 | Planococcus versutus |
| 50 | 1612371 | 1612553 | - | NZ_CP013661.2 | Planococcus kocurii |
| 51 | 2749950 | 2750126 | + | NZ_LR134441.1 | Kaistella antarctica |
| 52 | 2984830 | 2985012 | + | NC_015844.1 | Zobellia galactanivorans |
| 53 | 3227943 | 3228131 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 54 | 1717811 | 1717987 | - | NZ_LR134503.1 | Kaistella jeonii |
| 55 | 1137946 | 1138122 | - | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 56 | 4492886 | 4493068 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 57 | 251661 | 251843 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 58 | 667787 | 667981 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 59 | 3820690 | 3820872 | - | NZ_CP016210.1 | Azoarcus olearius |
| 60 | 3802141 | 3802299 | - | NZ_LT899436.1 | Tenacibaculum jejuense |
| 61 | 338933 | 339115 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 62 | 1694455 | 1694637 | - | NZ_CP040812.1 | Antarcticibacterium flavum |
| 63 | 1839524 | 1839700 | + | NZ_CP033924.1 | Chryseobacterium lactis |
| 64 | 179141 | 179320 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 65 | 3262890 | 3263063 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 66 | 5085641 | 5085823 | - | NZ_CP039126.1 | Blautia producta |
| 67 | 25685 | 25864 | + | NZ_CP034562.1 | Flammeovirga pectinis |
| 68 | 2510859 | 2511041 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 69 | 593880 | 594062 | - | NZ_CP031188.1 | Flavobacterium arcticum |
| 70 | 1937077 | 1937235 | + | NZ_CP037755.1 | Pseudocnuella soli |
| 71 | 724005 | 724169 | + | NZ_CP035504.1 | Kocuria indica |
| 72 | 174465 | 174644 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 73 | 811746 | 811928 | - | NZ_CP029463.1 | Flavobacterium sediminis |
| 74 | 274990 | 275169 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 75 | 141985 | 142164 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 76 | 509591 | 509773 | + | NZ_CP030280.1 | Blautia argi |
| 77 | 1921330 | 1921515 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
| 78 | 2774235 | 2774417 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 79 | 3270243 | 3270425 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 80 | 4204816 | 4204998 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 81 | 1193576 | 1193752 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 82 | 3216972 | 3217148 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 83 | 2432714 | 2432893 | + | NC_015167.1 | Cellulophaga lytica DSM 7489 |
| 84 | 82904 | 83065 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 85 | 3069732 | 3069920 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 86 | 1116809 | 1116991 | - | NZ_CP013355.1 | Lutibacter profundi |
| 87 | 690264 | 690446 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 88 | 275387 | 275572 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 89 | 1259853 | 1260035 | + | NZ_CP064781.1 | Azospira restricta |
| 90 | 3239868 | 3240050 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 91 | 372653 | 372835 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 92 | 2269585 | 2269764 | - | NZ_CP019288.1 | Kordia antarctica |
| 93 | 4606334 | 4606516 | - | NZ_CP070326.1 | Streptomyces noursei |
| 94 | 278932 | 279111 | + | NC_022549.1 | Acholeplasma brassicae |
| 95 | 1827977 | 1828138 | - | NZ_LT906439.1 | Streptococcus merionis |
| 96 | 491188 | 491370 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 97 | 669283 | 669465 | + | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 98 | 4164428 | 4164610 | + | NZ_CP025791.1 | Flavivirga eckloniae |
| 99 | 4676672 | 4676854 | + | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 100 | 1995564 | 1995740 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 101 | 569087 | 569263 | - | NZ_LR134476.1 | Trueperella bialowiezensis |
| 102 | 2454252 | 2454413 | - | NZ_CP014646.1 | Thauera humireducens |
| 103 | 2080206 | 2080388 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 104 | 592819 | 592968 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 105 | 90340 | 90501 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 106 | 1497263 | 1497445 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 107 | 2986377 | 2986553 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 108 | 4306853 | 4307035 | - | NZ_CP021455.1 | Comamonas serinivorans |
| 109 | 3848978 | 3849127 | - | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 110 | 812176 | 812355 | - | NZ_CP022957.1 | Maribacter cobaltidurans |
| 111 | 3227249 | 3227410 | + | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 112 | 2903814 | 2903975 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 113 | 1900262 | 1900423 | + | NZ_CP018839.1 | Thauera chlorobenzoica |
| 114 | 478046 | 478228 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 115 | 1875339 | 1875521 | - | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 116 | 5873217 | 5873393 | + | NZ_CP048113.1 | Chitinophaga agri |
| 117 | 1973650 | 1973835 | + | NC_013132.1 | Chitinophaga pinensis DSM 2588 |
| 118 | 2935434 | 2935616 | - | NC_008571.1 | Gramella forsetii KT0803 |
| 119 | 862883 | 863065 | - | NZ_CP054494.1 | Flavobacterium columnare |
| 120 | 6020484 | 6020669 | + | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 121 | 3384627 | 3384809 | + | NZ_CP012898.1 | Algibacter alginicilyticus |
| 122 | 837184 | 837366 | - | NZ_CP039456.1 | Changchengzhania lutea |
| 123 | 1330645 | 1330794 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 124 | 2148594 | 2148773 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 125 | 904289 | 904477 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 126 | 2174896 | 2175054 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 127 | 791043 | 791222 | - | NZ_CP025938.1 | Tamlana carrageenivorans |
| 128 | 1216789 | 1216971 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 129 | 2064749 | 2064928 | + | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 130 | 1676571 | 1676753 | + | NZ_CP042831.1 | Flavobacterium alkalisoli |
| 131 | 705812 | 705994 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 132 | 2456460 | 2456612 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 133 | 499940 | 500095 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 134 | 1987262 | 1987441 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 135 | 2458500 | 2458685 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 136 | 228719 | 228901 | - | NZ_CP007202.1 | Siansivirga zeaxanthinifaciens CC-SAMT-1 |
| 137 | 2007296 | 2007478 | + | NZ_CP020919.1 | Flavobacterium kingsejongi |
| 138 | 3250802 | 3250963 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 139 | 1069268 | 1069450 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 140 | 2629074 | 2629250 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 141 | 4574383 | 4574565 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 142 | 2941738 | 2941917 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 143 | 4272569 | 4272751 | + | NC_020990.1 | Streptomyces albidoflavus |
| 144 | 3536283 | 3536465 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 145 | 1610282 | 1610464 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007530.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00410.21 | 1.0 | 144 | 1496 | same-strand | Ribosomal protein S8 |
| 2 | PF00347.25 | 1.0 | 144 | 928 | same-strand | Ribosomal protein L6 |
| 3 | PF00861.24 | 0.98 | 141 | 542.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 4 | PF00333.22 | 1.0 | 144 | 14 | same-strand | Ribosomal protein S5, N-terminal domain |
| 5 | PF03719.17 | 1.0 | 144 | 14 | same-strand | Ribosomal protein S5, C-terminal domain |
| 6 | PF00828.21 | 0.99 | 142 | 17 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 7 | PF00344.22 | 0.99 | 143 | 475.0 | same-strand | SecY |
| 8 | PF00253.23 | 0.88 | 127 | 1936.0 | same-strand | Ribosomal protein S14p/S29e |
| 9 | PF01176.21 | 0.7 | 101 | 2607.5 | same-strand | Translation initiation factor 1A / IF-1 |
++ More..