Result : Q73PK2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | AE017226.1 |
| Organism | Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) |
| Left | 820999 |
| Right | 821283 |
| Strand | + |
| Nucleotide Sequence | ATGGATAAGGAAACTTTGAGAGCTCTTCATGTTATAGTCAAAGGAAGGGTTCAAGGTGTGGGCTTCAGGTATTGGACCCGTTCTCTTGCAAAGAGCCTCAATGTAAAGGGACGGGTTCGAAACCTTGCCGATTACTCTGTTGAAATTATTGCCGAAGCCGATACCGATACTTTGGGAGAATTCGTTTATGCTCTCAAGCACGAGCATCCTTATGCCCGTGTTGAAAGCCTAAATTCAGAAGAGGTAAGGGCTCGAGGTTATACAGACTTTCGGATTGAAGTATAA |
| Sequence | MDKETLRALHVIVKGRVQGVGFRYWTRSLAKSLNVKGRVRNLADYSVEIIAEADTDTLGEFVYALKHEHPYARVESLNSEEVRARGYTDFRIEV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 15064399 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q73PK2 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 820999 | 821283 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 2 | 478121 | 478405 | - | NZ_CP009228.1 | Treponema putidum |
| 3 | 823166 | 823399 | - | NC_022097.1 | Treponema pedis str. T A4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002967.9
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01196.21 | 0.67 | 2 | 1932.0 | same-strand | Ribosomal protein L17 |
| 2 | PF03013.16 | 0.67 | 2 | 1322.5 | opposite-strand | Pyrimidine dimer DNA glycosylase |
| 3 | PF08349.13 | 0.67 | 2 | 934.5 | opposite-strand | Protein of unknown function (DUF1722) |
| 4 | PF13347.8 | 0.67 | 2 | 36.5 | opposite-strand | MFS/sugar transport protein |
| 5 | PF00583.27 | 0.67 | 2 | 2259.5 | opposite-strand | Acetyltransferase (GNAT) family |
| 6 | PF13508.9 | 0.67 | 2 | 2259.5 | opposite-strand | Acetyltransferase (GNAT) domain |
++ More..