Result : Q73NX7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | AE017226.1 |
| Organism | Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) |
| Left | 1057241 |
| Right | 1057429 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGTACCAAGAGCGAATACATCAAAAGCTAGAACAAGACGCCGACGCGGTGTTAATATGCGTTTACAAGCGCCAAATCTTGTTGAGTGTTCCGGATGCGGTAATTTGATTATGCCTCATCATGTATGCCCCAAATGCGGGTTTTATAAAGGCAAGCAGGTTATTAACCCCGATAAATTAGACTAA |
| Sequence | MAVPRANTSKARTRRRRGVNMRLQAPNLVECSGCGNLIMPHHVCPKCGFYKGKQVINPDKLD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15064399 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q73NX7 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 157
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1057241 | 1057429 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 2 | 128739 | 128927 | - | NZ_CP009228.1 | Treponema putidum |
| 3 | 2417201 | 2417389 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 4 | 1200984 | 1201172 | + | NZ_CP031518.1 | Treponema ruminis |
| 5 | 1672606 | 1672791 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 6 | 872238 | 872426 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 7 | 1489658 | 1489846 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 8 | 1264498 | 1264686 | + | NZ_CP054142.1 | Treponema parvum |
| 9 | 1298886 | 1299074 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 10 | 1594787 | 1594975 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 11 | 2856520 | 2856708 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 12 | 3136957 | 3137145 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 13 | 1296318 | 1296506 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 14 | 1858766 | 1858954 | + | NC_023035.1 | Salinispira pacifica |
| 15 | 600157 | 600345 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 16 | 1146914 | 1147090 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 17 | 721994 | 722170 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 18 | 608992 | 609177 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 19 | 2039994 | 2040182 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 20 | 2275113 | 2275295 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 21 | 2135682 | 2135864 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 22 | 1753959 | 1754144 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 23 | 2476313 | 2476498 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 24 | 2393360 | 2393542 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 25 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 26 | 1776610 | 1776798 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 27 | 540816 | 541001 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 28 | 523933 | 524115 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 29 | 782745 | 782927 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 30 | 1588058 | 1588231 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 31 | 896379 | 896558 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 32 | 1184675 | 1184857 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 33 | 2904453 | 2904632 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 34 | 1548425 | 1548607 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 35 | 1402720 | 1402905 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 36 | 1416340 | 1416525 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 37 | 672019 | 672201 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 38 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 39 | 32541 | 32723 | + | NZ_HF545617.1 | Ruminococcus bicirculans |
| 40 | 1786985 | 1787185 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 41 | 1257525 | 1257704 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 42 | 1052505 | 1052684 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 43 | 890727 | 890909 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 44 | 770235 | 770426 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 45 | 2098096 | 2098269 | - | NZ_LT906444.1 | Listeria welshimeri |
| 46 | 1812295 | 1812474 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 47 | 4133809 | 4133982 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 48 | 1046423 | 1046596 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 49 | 1829739 | 1829921 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 50 | 2315011 | 2315190 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 51 | 3276683 | 3276862 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 52 | 2088361 | 2088534 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 53 | 2190971 | 2191144 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 54 | 2130228 | 2130401 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 55 | 1372908 | 1373087 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 56 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 57 | 1512956 | 1513132 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 58 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 59 | 2177879 | 2178052 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 60 | 1074157 | 1074336 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 61 | 3488121 | 3488294 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 62 | 2971550 | 2971729 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 63 | 786562 | 786738 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 64 | 1219651 | 1219836 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 65 | 1473534 | 1473707 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 66 | 2429174 | 2429353 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 67 | 1009182 | 1009361 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 68 | 1619826 | 1620005 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 69 | 949528 | 949707 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 70 | 1784177 | 1784356 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 71 | 1117535 | 1117717 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 72 | 750013 | 750195 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 73 | 824255 | 824437 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 74 | 1221850 | 1222038 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 75 | 37539 | 37718 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 76 | 2861270 | 2861449 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 77 | 478458 | 478637 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 78 | 636194 | 636373 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 79 | 2412407 | 2412592 | + | NZ_CP039126.1 | Blautia producta |
| 80 | 312581 | 312760 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 81 | 1052967 | 1053140 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 82 | 47802 | 47978 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 83 | 456012 | 456191 | - | NC_006055.1 | Mesoplasma florum L1 |
| 84 | 503440 | 503619 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 85 | 512482 | 512661 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
| 86 | 472750 | 472929 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
| 87 | 501574 | 501753 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
| 88 | 2355137 | 2355316 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 89 | 550443 | 550631 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 90 | 1661277 | 1661450 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 91 | 1332474 | 1332647 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 92 | 1318504 | 1318683 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 93 | 3654768 | 3654950 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 94 | 1147125 | 1147304 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 95 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 96 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 97 | 1135739 | 1135918 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 98 | 243753 | 243926 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 99 | 356905 | 357102 | - | NZ_CP055143.1 | Mycoplasma hominis |
| 100 | 787142 | 787321 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 101 | 1804594 | 1804776 | + | NZ_CP048649.1 | Aminipila butyrica |
| 102 | 524702 | 524875 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 103 | 1206918 | 1207097 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 104 | 1343755 | 1343928 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 105 | 4116117 | 4116299 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 106 | 621077 | 621259 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 107 | 1466409 | 1466582 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 108 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 109 | 3362575 | 3362748 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 110 | 2709716 | 2709889 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 111 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 112 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 113 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 114 | 5381 | 5569 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 115 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 116 | 2046639 | 2046818 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 117 | 1556094 | 1556270 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 118 | 2535783 | 2535959 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 119 | 2242608 | 2242781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 120 | 926536 | 926715 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 121 | 1901972 | 1902148 | + | NZ_CP036259.1 | Sporomusa termitida |
| 122 | 1419168 | 1419353 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 123 | 2189694 | 2189885 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 124 | 1660735 | 1660920 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 125 | 362568 | 362747 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 126 | 1843396 | 1843578 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 127 | 1023814 | 1024002 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 128 | 1679672 | 1679845 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 129 | 1702316 | 1702489 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 130 | 406708 | 406887 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 131 | 2299250 | 2299426 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 132 | 146572 | 146772 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 133 | 803030 | 803233 | - | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 134 | 1700206 | 1700379 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 135 | 458503 | 458697 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 136 | 323450 | 323653 | - | NZ_LR215032.1 | Mycoplasmopsis gallopavonis |
| 137 | 2065775 | 2065960 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 138 | 484587 | 484772 | - | NZ_LT996885.1 | Dialister massiliensis |
| 139 | 1906456 | 1906644 | - | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 140 | 769572 | 769763 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 141 | 702296 | 702487 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 142 | 1457822 | 1458007 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 143 | 4159757 | 4159948 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 144 | 3036211 | 3036399 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 145 | 747551 | 747733 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 146 | 260028 | 260228 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 147 | 759077 | 759259 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 148 | 1241516 | 1241692 | - | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 149 | 2169749 | 2169925 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 150 | 744620 | 744802 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 151 | 744795 | 744977 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 152 | 765421 | 765603 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 153 | 169613 | 169789 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 154 | 734820 | 735002 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 155 | 737937 | 738119 | + | NZ_CP044535.1 | Borrelia maritima |
| 156 | 741073 | 741255 | + | NZ_CP015796.1 | Borreliella mayonii |
| 157 | 743124 | 743306 | + | NZ_CP028861.1 | Borreliella garinii |
| 158 | 528961 | 529158 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016630.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.62 | 98 | 49 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
++ More..