Result : Q73N17
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative septation protein SpoVG |
| NCBI Accession ID | AE017226.1 |
| Organism | Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) |
| Left | 1375947 |
| Right | 1376228 |
| Strand | + |
| Nucleotide Sequence | ATGGAAATTACAGAAGTCCGTGTTCAGAGAGTGAGTCCGGGGAATAGTTTAAAGGCTTATGCTAATATTACGTTTGATGATTGCTTTGTCCTTCATAATGTAAGAGTGATCGAGGGTAATGACGGTTTGTACATTGGAATGCCCAGCCGGAAGTTGAGTAACGGTGAGTTTAAAAATATAGCTCATCCTATCACTGCCGAGTTTAGGGAAAAGATGACAAAGGCTGTTTTGGAGGTTTACGAAAAAACACCTATTATGCCCGGGCAAGAGGCTGAAATCTAG |
| Sequence | MEITEVRVQRVSPGNSLKAYANITFDDCFVLHNVRVIEGNDGLYIGMPSRKLSNGEFKNIAHPITAEFREKMTKAVLEVYEKTPIMPGQEAEI |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in septation. {ECO:0000255|HAMAP-Rule:MF_00819}. |
| Pubmed ID | 15064399 |
| Domain | CDD:412646 |
| Functional Category | Others |
| Uniprot ID | Q73N17 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 111
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1375947 | 1376228 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 2 | 2714325 | 2714606 | - | NZ_CP009228.1 | Treponema putidum |
| 3 | 1585245 | 1585499 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 4 | 1198525 | 1198827 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 5 | 1958330 | 1958608 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 6 | 1534541 | 1534825 | + | NC_023035.1 | Salinispira pacifica |
| 7 | 870308 | 870589 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 8 | 2147145 | 2147444 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 9 | 2099663 | 2099941 | + | NZ_CP031518.1 | Treponema ruminis |
| 10 | 3287045 | 3287329 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 11 | 2685432 | 2685713 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 12 | 2113594 | 2113878 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 13 | 3561041 | 3561319 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 14 | 3110726 | 3111007 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 15 | 189753 | 190028 | + | NZ_CP014204.2 | Clostridium baratii |
| 16 | 25515 | 25790 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 17 | 884584 | 884838 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 18 | 4591589 | 4591867 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 19 | 1936260 | 1936523 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 20 | 2724860 | 2725150 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 21 | 2962234 | 2962521 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 22 | 2154012 | 2154302 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 23 | 4521242 | 4521532 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 24 | 2505125 | 2505391 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 25 | 2350963 | 2351253 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 26 | 76078 | 76362 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 27 | 3075372 | 3075644 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 28 | 50428 | 50712 | + | NZ_CP016540.2 | Planococcus versutus |
| 29 | 2162871 | 2163158 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 30 | 148197 | 148472 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 31 | 1128044 | 1128334 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 32 | 2580128 | 2580424 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 33 | 63412 | 63675 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 34 | 133822 | 134124 | + | NC_008593.1 | Clostridium novyi NT |
| 35 | 353983 | 354249 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 36 | 367156 | 367422 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 37 | 135810 | 136100 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 38 | 126929 | 127204 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 39 | 5372717 | 5373007 | - | NZ_CP020953.1 | Clostridium drakei |
| 40 | 4516057 | 4516347 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 41 | 4551455 | 4551745 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 42 | 44740 | 45042 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 43 | 2033589 | 2033879 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 44 | 2035820 | 2036083 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 45 | 3625658 | 3625933 | - | NZ_CP030775.1 | Clostridium butyricum |
| 46 | 3763771 | 3764058 | - | NZ_CP028842.1 | Clostridium botulinum |
| 47 | 4044792 | 4045079 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 48 | 2273415 | 2273681 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 49 | 2332127 | 2332393 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 50 | 102620 | 102895 | + | NZ_CP043998.1 | Clostridium diolis |
| 51 | 361870 | 362136 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 52 | 2632500 | 2632766 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 53 | 2130324 | 2130590 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 54 | 2689403 | 2689669 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 55 | 2550878 | 2551144 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 56 | 2170009 | 2170287 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 57 | 2287459 | 2287737 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 58 | 158631 | 158912 | + | NZ_CP016786.1 | Clostridium isatidis |
| 59 | 3450794 | 3451084 | - | NZ_CP040924.1 | Clostridium thermarum |
| 60 | 1983512 | 1983778 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 61 | 2463420 | 2463695 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 62 | 112221 | 112496 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 63 | 2646225 | 2646518 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 64 | 2274778 | 2275065 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 65 | 2480167 | 2480448 | - | NZ_LN879430.1 | Herbinix luporum |
| 66 | 55984 | 56268 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 67 | 1536303 | 1536596 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 68 | 343775 | 344062 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 69 | 3374577 | 3374864 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 70 | 980919 | 981203 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 71 | 2209600 | 2209878 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 72 | 2474553 | 2474834 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 73 | 697037 | 697321 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 74 | 4013428 | 4013715 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 75 | 38147 | 38431 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 76 | 153718 | 153999 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 77 | 540453 | 540740 | + | NZ_CP014176.1 | Clostridium argentinense |
| 78 | 1067796 | 1068068 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 79 | 188287 | 188568 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 80 | 80114 | 80407 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 81 | 64299 | 64598 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 82 | 825270 | 825557 | + | NZ_CP034437.1 | Paenibacillus albus |
| 83 | 216232 | 216516 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 84 | 5342759 | 5343043 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 85 | 3582378 | 3582662 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 86 | 5295376 | 5295660 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 87 | 174146 | 174424 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 88 | 2617192 | 2617470 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 89 | 1374924 | 1375217 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 90 | 236915 | 237199 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 91 | 296171 | 296455 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 92 | 3176818 | 3177102 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 93 | 37466 | 37753 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 94 | 44095 | 44385 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 95 | 1475476 | 1475754 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 96 | 3744096 | 3744380 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 97 | 3194665 | 3194949 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 98 | 5622825 | 5623112 | - | NZ_CP039126.1 | Blautia producta |
| 99 | 155185 | 155421 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 100 | 894787 | 895074 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 101 | 3321902 | 3322141 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 102 | 45516 | 45776 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 103 | 221776 | 222033 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 104 | 229000 | 229281 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 105 | 1458971 | 1459261 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 106 | 203850 | 204107 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 107 | 146427 | 146708 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 108 | 1142964 | 1143254 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 109 | 252515 | 252805 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 110 | 3949741 | 3950028 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 111 | 63367 | 63654 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014204.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09182.12 | 0.74 | 82 | 176.0 | same-strand | Bacterial purine repressor, N-terminal |
| 2 | PF00132.26 | 0.74 | 82 | 167 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 3 | PF00483.25 | 0.73 | 81 | 172.5 | same-strand | Nucleotidyl transferase |
| 4 | PF14602.8 | 0.68 | 76 | 176.5 | same-strand | Hexapeptide repeat of succinyl-transferase |
| 5 | PF13793.8 | 0.68 | 75 | 1601 | same-strand | N-terminal domain of ribose phosphate pyrophosphokinase |
++ More..