Protein Information |
Information Type | Description |
---|---|
Protein name | Citrate lyase acyl carrier protein (Citrate lyase gamma chain) |
NCBI Accession ID | AE017226.1 |
Organism | Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) |
Left | 1682518 |
Right | 1682781 |
Strand | - |
Nucleotide Sequence | ATGCAAATAAAACGAGAAGCGGTTTGCGGAACACTCCAATCAAATGATTGCCTTGTCCGTATTGTTCCTTCCGAAAAACTTGAACTTGACTTAAAAAGCTCTGTTTTAAACGAATTCGGTGCACAGATTAAAAAAACGGTGCAGGAAGTATTGGATGAGTTTGAAGTAAAAAATGCCAAACTCTTTATCGAAGACAAGGGCGCCTTAGATTGTACAATCAAGGCCCGTGTAGAAACAGCATTGAGGCGCGCAAATGAAAAATAG |
Sequence | MQIKREAVCGTLQSNDCLVRIVPSEKLELDLKSSVLNEFGAQIKKTVQEVLDEFEVKNAKLFIEDKGALDCTIKARVETALRRANEK |
Source of smORF | Swiss-Prot |
Function | Covalent carrier of the coenzyme of citrate lyase. {ECO:0000255|HAMAP-Rule:MF_00805}. |
Pubmed ID | 15064399 |
Domain | CDD:414649 |
Functional Category | Others |
Uniprot ID | Q73M76 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1682518 | 1682781 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
2 | 2381696 | 2381971 | - | NZ_CP009228.1 | Treponema putidum |
3 | 2252325 | 2252588 | + | NC_022097.1 | Treponema pedis str. T A4 |
4 | 1277589 | 1277885 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
5 | 1439397 | 1439636 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
6 | 1709098 | 1709391 | - | NZ_LR594050.1 | Streptococcus porcinus |
7 | 309366 | 309674 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
8 | 3436557 | 3436865 | - | NZ_LT906479.1 | Serratia ficaria |
9 | 2045990 | 2046253 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
10 | 4413220 | 4413483 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
11 | 1701456 | 1701764 | + | NZ_CP071320.1 | Serratia ureilytica |
12 | 3384437 | 3384745 | - | NZ_CP038662.1 | Serratia nematodiphila |
13 | 897004 | 897306 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
14 | 1912505 | 1912792 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
15 | 2682140 | 2682448 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
16 | 3443109 | 3443417 | - | NZ_CP048784.1 | Serratia liquefaciens |
17 | 3492724 | 3493005 | - | NZ_LR134494.1 | Serratia quinivorans |
18 | 2943458 | 2943757 | + | NZ_CP070062.1 | Coprococcus comes |
19 | 187371 | 187667 | + | NZ_CP009787.1 | Yersinia rohdei |
20 | 2922593 | 2922886 | - | NZ_CP043727.1 | Yersinia canariae |
21 | 2381584 | 2381877 | - | NZ_CP032487.1 | Yersinia hibernica |
22 | 2913137 | 2913430 | - | NZ_CP011118.1 | Yersinia enterocolitica |
23 | 27254 | 27550 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
24 | 3789968 | 3790267 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
25 | 3044891 | 3045184 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
26 | 5261310 | 5261573 | - | NZ_CP020953.1 | Clostridium drakei |
27 | 145799 | 146080 | + | NZ_LR134524.1 | Peptoniphilus harei |
28 | 2733886 | 2734182 | - | NZ_AP014635.1 | Vibrio tritonius |
29 | 5518302 | 5518610 | - | NZ_CP011254.1 | Serratia fonticola |
30 | 3509467 | 3509775 | - | NC_015567.1 | Serratia plymuthica AS9 |
31 | 141288 | 141593 | + | NZ_CP039712.1 | Vagococcus zengguangii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04223.14 | 1.0 | 31 | 897 | same-strand | Citrate lyase, alpha subunit (CitF) |
2 | PF03328.16 | 1.0 | 31 | -3 | same-strand | HpcH/HpaI aldolase/citrate lyase family |
3 | PF08218.13 | 0.84 | 26 | 97.0 | same-strand | Citrate lyase ligase C-terminal domain |
4 | PF03802.16 | 0.77 | 24 | 2414.0 | same-strand | Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase |
5 | PF01874.18 | 0.74 | 23 | 2942 | same-strand | ATP:dephospho-CoA triphosphoribosyl transferase |