Result : Q73M32
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | AE017226.1 |
| Organism | Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) |
| Left | 1730292 |
| Right | 1730573 |
| Strand | - |
| Nucleotide Sequence | ATGAGAAACTATGAACTTATGACGGTTTTTCCGGTTGAAGAGGATCTCTATAAACCGGGAATAGATGCTCTACATTCAATTCTGGCGGATTTCGGTGTTCAGATCAAATCTGAAGAGCCTTTCGGCGATCGGGATTTAGCTTATGAAATCAAAAAGAAGACAAAGGGACGTTATGTGCTTTTCAACATTGAAGCAGATCCTGCAAAGATGATTGAATTGGATAAGCGTTTTAAGCTGATCACTCAGATGTTGACCTATCTTTTTGTTCGTTTAGAGGACTAA |
| Sequence | MRNYELMTVFPVEEDLYKPGIDALHSILADFGVQIKSEEPFGDRDLAYEIKKKTKGRYVLFNIEADPAKMIELDKRFKLITQMLTYLFVRLED |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 15064399 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q73M32 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2239349 | 2239630 | + | NZ_CP009228.1 | Treponema putidum |
| 2 | 1730292 | 1730573 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 3 | 1499863 | 1500144 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 4 | 1687280 | 1687561 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 5 | 1364669 | 1364962 | - | NZ_CP054142.1 | Treponema parvum |
| 6 | 1318721 | 1319011 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 7 | 1854711 | 1854992 | + | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 8 | 1493774 | 1494055 | + | NC_015578.1 | Treponema primitia ZAS-2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015500.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00436.27 | 1.0 | 8 | 14.5 | same-strand | Single-strand binding protein family |
| 2 | PF01084.22 | 1.0 | 8 | 541.0 | same-strand | Ribosomal protein S18 |
| 3 | PF01281.21 | 1.0 | 8 | 959.5 | same-strand | Ribosomal protein L9, N-terminal domain |
| 4 | PF03948.16 | 1.0 | 8 | 959.5 | same-strand | Ribosomal protein L9, C-terminal domain |
| 5 | PF03796.17 | 0.62 | 5 | 1895 | same-strand | DnaB-like helicase C terminal domain |
| 6 | PF00772.23 | 0.62 | 5 | 1895 | same-strand | DnaB-like helicase N terminal domain |
++ More..