Result : Q73HK1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0335 protein WD_0557 |
| NCBI Accession ID | AE017196.1 |
| Organism | Wolbachia pipientis wMel |
| Left | 542719 |
| Right | 542985 |
| Strand | - |
| Nucleotide Sequence | ATGGAAGATACAGTAAAAATAACGGCTGAAGAGTTGAAGGGTTACATAGAGAGAATCGAAAAACTTGAACAAGAAAAGAGGGATGTGCAAGATCACATTCGTGATGTATATGCAAAAGCCGCAGATGAAGGTTGGGATATAAAAGTGATGAAACAAATTATTAGGCTGAGGAAGATGGATGATGATGACAGAGAGGAACAAGAAATATTGCTTGATACCTATAAACGTGCATTGGGAATGAGCTACGAAGAAGAGTTAAGTGAATAG |
| Sequence | MEDTVKITAEELKGYIERIEKLEQEKRDVQDHIRDVYAKAADEGWDIKVMKQIIRLRKMDDDDREEQEILLDTYKRALGMSYEEELSE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23845. Profile Description: Uncharacterized protein conserved in bacteria (DUF2312). hypothetical protein; Provisional |
| Pubmed ID | 15024419 |
| Domain | CDD:420047 |
| Functional Category | Others |
| Uniprot ID | Q73HK1 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1328890 | 1329138 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 2 | 2829273 | 2829521 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 3 | 578226 | 578453 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 4 | 671925 | 672164 | + | NC_007354.1 | Ehrlichia canis str. Jake |
| 5 | 600217 | 600498 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 6 | 206846 | 207094 | + | NZ_CP029833.1 | Azospirillum ramasamyi |
| 7 | 1871417 | 1871665 | + | NZ_CP054619.1 | Azospirillum oryzae |
| 8 | 1712771 | 1713022 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 9 | 3974511 | 3974771 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 10 | 2110028 | 2110297 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 11 | 2072317 | 2072562 | + | NZ_CP031555.1 | Thalassospira indica |
| 12 | 1494636 | 1494881 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 13 | 779302 | 779586 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 14 | 259592 | 259855 | + | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 15 | 3419326 | 3419601 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 16 | 67015 | 67251 | - | NZ_CP025612.1 | Niveispirillum cyanobacteriorum |
| 17 | 323248 | 323490 | + | NZ_CP060052.1 | Croceicoccus marinus |
| 18 | 6092365 | 6092604 | - | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 19 | 1804739 | 1804975 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 20 | 728585 | 728809 | - | NZ_CP027407.1 | Roseobacter denitrificans |
| 21 | 871980 | 872216 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 22 | 1656801 | 1657061 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 23 | 1380273 | 1380539 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 24 | 3470608 | 3470850 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 25 | 2119614 | 2119850 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 26 | 1971634 | 1971876 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 27 | 373424 | 373687 | + | NZ_CP010803.1 | Martelella endophytica |
| 28 | 806708 | 806971 | - | NZ_AP019700.1 | Stella humosa |
| 29 | 4874026 | 4874265 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 30 | 1081577 | 1081837 | + | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 31 | 1471789 | 1472016 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 32 | 4657876 | 4658115 | + | NZ_CP061038.1 | Sphingomonas alpina |
| 33 | 2827626 | 2827874 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 34 | 3276017 | 3276280 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 35 | 965627 | 965878 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 36 | 1094621 | 1094875 | - | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 37 | 747782 | 748045 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 38 | 2980401 | 2980667 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 39 | 2328854 | 2329117 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 40 | 3567 | 3830 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 41 | 2659371 | 2659622 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 42 | 2408071 | 2408328 | + | NZ_CP016428.1 | Bradyrhizobium icense |
| 43 | 3069340 | 3069609 | - | NC_015684.1 | Afipia carboxidovorans OM5 |
| 44 | 442993 | 443220 | + | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 45 | 2561942 | 2562184 | - | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 46 | 2455334 | 2455579 | + | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 47 | 901828 | 902079 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 48 | 185372 | 185638 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 49 | 3073227 | 3073469 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 50 | 3337299 | 3337541 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 51 | 2012059 | 2012310 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 52 | 3542711 | 3542953 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 53 | 2269593 | 2269835 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 54 | 4227435 | 4227674 | + | NZ_CP014168.1 | Sphingomonas panacis |
| 55 | 342320 | 342547 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 56 | 550345 | 550617 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 57 | 5768167 | 5768427 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 58 | 1096697 | 1096972 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 59 | 1482985 | 1483260 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 60 | 694337 | 694597 | + | NZ_CP010522.1 | Liberibacter crescens |
| 61 | 737395 | 737670 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 62 | 931851 | 932084 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 63 | 1906125 | 1906397 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 64 | 812763 | 813035 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 65 | 2171257 | 2171532 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 66 | 1572133 | 1572405 | - | NZ_CP015164.1 | Acetobacter ascendens |
| 67 | 905742 | 905984 | - | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 68 | 2126721 | 2126993 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 69 | 4594517 | 4594789 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 70 | 8705 | 8983 | - | NZ_CP042809.1 | Acetobacter oryzoeni |
| 71 | 4456628 | 4456870 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 72 | 4542413 | 4542658 | - | NZ_CP042906.1 | Hypericibacter terrae |
++ More..