Result : Q73AH3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein H 2 (SASP H 2) |
| NCBI Accession ID | AE017194.1 |
| Organism | Bacillus cereus (strain ATCC 10987 / NRS 248) |
| Left | 1745750 |
| Right | 1745929 |
| Strand | - |
| Nucleotide Sequence | ATGAATATTCAACGTGCAAAAGAGCTTTCTGTGTCAGCAGAGCAAGCGAATGTTAGTTTTCAAGGCATGCCTGTTATGATTCAACACGTCGACGAGAGCAATGAAACCGCCCGCATATATGAAGTAAAAAACCCAGGACGCGAATTAACAGTTCCAGTTAATAGCTTAGAGGAAATATAA |
| Sequence | MNIQRAKELSVSAEQANVSFQGMPVMIQHVDESNETARIYEVKNPGRELTVPVNSLEEI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl06949. Profile Description: Small acid-soluble spore protein H family. This model is derived from pfam08141 but has been expanded to include in the seed corresponding proteins from three species of Clostridium. Members of this family should occur only in endospore-forming bacteria, typically with two members per genome, but may be absent from the genomes of some endospore-forming bacteria. SspH (previously designated YfjU) was shown to be expressed specifically in spores of Bacillus subtilis. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 14960714 |
| Domain | CDD:414973 |
| Functional Category | Others |
| Uniprot ID | Q73AH3 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1623534 | 1623713 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 1657660 | 1657839 | - | NC_011725.1 | Bacillus cereus B4264 |
| 3 | 1601282 | 1601461 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 1628449 | 1628628 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 5 | 3477311 | 3477490 | + | NZ_CP040336.1 | Bacillus luti |
| 6 | 1487661 | 1487840 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 1350798 | 1350986 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 8 | 495985 | 496179 | + | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 9 | 2174148 | 2174330 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 10 | 1964080 | 1964262 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 11 | 418160 | 418339 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 12 | 543206 | 543385 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 13 | 1453532 | 1453711 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 14 | 776044 | 776238 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 15 | 2252575 | 2252769 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 16 | 1456258 | 1456452 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 17 | 3132514 | 3132693 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 18 | 1832884 | 1833063 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 19 | 2133962 | 2134138 | - | NZ_CP009288.1 | Paenibacillus durus |
| 20 | 2327301 | 2327480 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 21 | 1955120 | 1955299 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 22 | 885629 | 885808 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 23 | 5778163 | 5778342 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 24 | 821710 | 821889 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 25 | 2509968 | 2510153 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 26 | 725079 | 725273 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 27 | 2874032 | 2874217 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 28 | 230994 | 231170 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
++ More..