Result : Q72S30
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0109 protein LIC_11556 |
| NCBI Accession ID | AE016823.1 |
| Organism | Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) |
| Left | 1919566 |
| Right | 1919796 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGAATTACTGAAGTACATAGTTGCTTCTCTTGTTGAATTTCCCGAAGAAATTGTAATTCGTGAAATTGAAGGGGAAGAACAAAATATCATCGAACTACGAGTCTCCCCGAAAGACGTGGGAAAAGTAATCGGTAAAAACGGTCGTATTGCAAAATCCCTGCGCGCGATTCTTACTGCGGCATCTGTAAAAGCAGGAAAAAACTTCTCCTTAGAAATCATTGACTAA |
| Sequence | MEELLKYIVASLVEFPEEIVIREIEGEEQNIIELRVSPKDVGKVIGKNGRIAKSLRAILTAASVKAGKNFSLEIID |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00098. Profile Description: K homology (KH) RNA-binding domain, type I. Rrp40, also called exosome component 3 (EXOSC3), or ribosomal RNA-processing protein 40, is a non-catalytic component of the RNA exosome complex which has 3'-->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. Mutations of EXOSC3 gene are associated with neurological diseases. Members in this subfamily contain a divergent KH domain that lacks the RNA-binding GXXG motif. |
| Pubmed ID | 15028702 |
| Domain | CDD:412160 |
| Functional Category | RNA-binding |
| Uniprot ID | Q72S30 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2363359 | 2363589 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 2 | 3108388 | 3108618 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 3 | 428739 | 428969 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 4 | 2103948 | 2104178 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 5 | 4209494 | 4209724 | + | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 6 | 2402125 | 2402355 | + | NZ_CP040840.1 | Leptospira weilii |
| 7 | 1391632 | 1391865 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 8 | 2084616 | 2084846 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 9 | 1010854 | 1011087 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 10 | 543800 | 543994 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 11 | 5757006 | 5757236 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 12 | 1413377 | 1413583 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 13 | 2319094 | 2319324 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 14 | 873196 | 873426 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 15 | 596683 | 596916 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 16 | 1214405 | 1214638 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 17 | 535506 | 535739 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 18 | 3730541 | 3730735 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 19 | 1290217 | 1290450 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 20 | 3505655 | 3505885 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 21 | 2411058 | 2411291 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 22 | 931368 | 931562 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 23 | 1432508 | 1432741 | - | NZ_CP009228.1 | Treponema putidum |
| 24 | 901589 | 901822 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 25 | 2090704 | 2090934 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 26 | 5465258 | 5465488 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 27 | 2873073 | 2873303 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 28 | 6750974 | 6751204 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 29 | 6455311 | 6455541 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 30 | 565653 | 565886 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 31 | 2032206 | 2032439 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 32 | 3012137 | 3012367 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 33 | 2287595 | 2287792 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 34 | 2617100 | 2617333 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 35 | 2208088 | 2208318 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 36 | 436424 | 436654 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 37 | 2322478 | 2322675 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 38 | 1884333 | 1884563 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 39 | 1278815 | 1279054 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 40 | 2016288 | 2016485 | + | NZ_CP019914.1 | Brachyspira hampsonii |
| 41 | 1286382 | 1286579 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 42 | 212250 | 212480 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 43 | 1251506 | 1251733 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 44 | 1713376 | 1713606 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 45 | 6105642 | 6105872 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 46 | 3238966 | 3239196 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 47 | 3753963 | 3754193 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 48 | 1447760 | 1447987 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 49 | 1945705 | 1945935 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 50 | 1420236 | 1420478 | + | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 51 | 2993507 | 2993704 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 52 | 1905388 | 1905615 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 53 | 187728 | 187967 | - | NZ_CP023671.1 | Clostridium septicum |
| 54 | 3683085 | 3683324 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 55 | 3702373 | 3702603 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 56 | 3747125 | 3747355 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 57 | 3001069 | 3001299 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 58 | 1166504 | 1166743 | - | NZ_CP016786.1 | Clostridium isatidis |
| 59 | 2640928 | 2641122 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 60 | 1852231 | 1852425 | + | NC_023035.1 | Salinispira pacifica |
| 61 | 1186150 | 1186377 | + | NZ_CP020953.1 | Clostridium drakei |
| 62 | 3081830 | 3082057 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 63 | 2204548 | 2204775 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 64 | 1577967 | 1578194 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 65 | 1472409 | 1472636 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 66 | 2377538 | 2377768 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 67 | 3906900 | 3907127 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 68 | 1405817 | 1406044 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 69 | 1482717 | 1482944 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 70 | 1228584 | 1228814 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 71 | 3258498 | 3258725 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 72 | 1307487 | 1307714 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 73 | 1419012 | 1419239 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 74 | 1162418 | 1162651 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 75 | 2165666 | 2165851 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 76 | 1303307 | 1303534 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 77 | 1281509 | 1281736 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 78 | 946577 | 946795 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 79 | 1887749 | 1887976 | - | NZ_HG917868.1 | Clostridium bornimense |
| 80 | 2962544 | 2962774 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 81 | 1126951 | 1127181 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 82 | 1439602 | 1439832 | + | NC_015318.1 | Hippea maritima DSM 10411 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011768.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 0.9 | 73 | 1414.0 | same-strand | Ribosomal protein L19 |
| 2 | PF01746.23 | 0.91 | 74 | 543 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 3 | PF01782.20 | 0.98 | 79 | 14.0 | same-strand | RimM N-terminal domain |
| 4 | PF00886.21 | 1.0 | 81 | 37.5 | same-strand | Ribosomal protein S16 |
| 5 | PF05239.18 | 0.77 | 62 | 33 | same-strand | PRC-barrel domain |
| 6 | PF00448.24 | 0.85 | 69 | 421.5 | same-strand | SRP54-type protein, GTPase domain |
| 7 | PF02978.21 | 0.85 | 69 | 357.5 | same-strand | Signal peptide binding domain |
| 8 | PF02881.21 | 0.85 | 69 | 421.5 | same-strand | SRP54-type protein, helical bundle domain |
++ More..