Result : Q72Q67
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | RNA-binding protein Hfq |
| NCBI Accession ID | AE016823.1 |
| Organism | Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) |
| Left | 2709154 |
| Right | 2709411 |
| Strand | - |
| Nucleotide Sequence | ATGTCTGCTAAAAACAATATACAGGACCAACTCTTAAACACTGCCCGGAAGGATAAATTGGATCTTACGATTTATCTACTGAACGGGGTTCCCTTGAAAGGCAAAGTGGTGAGCTTCGATAATTTTACGATTGTGCTCGAACAAGAAAATAAACAGAGCCTCGTTTATAAACACGCTATTTCTACGATCATTCCCGCCAAGATTATCAAGCTATATACCGAGGAAGCAAAAGACAATAAAGACGCAGCTCAAGGATAA |
| Sequence | MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQSLVYKHAISTIIPAKIIKLYTEEAKDNKDAAQG |
| Source of smORF | Swiss-Prot |
| Function | RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs. {ECO:0000255|HAMAP-Rule:MF_00436}. |
| Pubmed ID | 15028702 |
| Domain | CDD:412267 |
| Functional Category | RNA-binding |
| Uniprot ID | Q72Q67 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 270
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 718827 | 719084 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 2 | 3776483 | 3776731 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 3 | 1501814 | 1502062 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 4 | 2655468 | 2655716 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 5 | 3415518 | 3415766 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 6 | 2928720 | 2928968 | - | NZ_CP040840.1 | Leptospira weilii |
| 7 | 3187799 | 3188011 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 8 | 1012334 | 1012612 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 9 | 251216 | 251446 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 10 | 4050702 | 4050950 | - | NZ_CP026100.1 | Caulobacter flavus |
| 11 | 2226857 | 2227087 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 12 | 2553956 | 2554189 | - | NZ_LS483476.1 | Lederbergia lentus |
| 13 | 1829403 | 1829654 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 14 | 1902279 | 1902527 | - | NZ_CP013002.1 | Caulobacter henricii |
| 15 | 2553095 | 2553340 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 16 | 2162721 | 2162969 | + | NZ_CP027850.1 | Caulobacter segnis |
| 17 | 3518204 | 3518449 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 18 | 2726985 | 2727233 | + | NZ_CP072611.1 | Aureimonas populi |
| 19 | 1538508 | 1538750 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 20 | 1133146 | 1133397 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 21 | 1113794 | 1114006 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 22 | 2802330 | 2802578 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 23 | 2067673 | 2067915 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 24 | 871944 | 872180 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 25 | 1397540 | 1397788 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 26 | 1109699 | 1109959 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 27 | 29177 | 29407 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 28 | 1878112 | 1878330 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 29 | 2482052 | 2482288 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 30 | 3172390 | 3172611 | + | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 31 | 2043239 | 2043457 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 32 | 1773345 | 1773590 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 33 | 2140441 | 2140662 | - | NZ_CP011937.1 | Bacillus velezensis |
| 34 | 1822684 | 1822905 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 35 | 2354438 | 2354680 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 36 | 2095823 | 2096044 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 37 | 1656342 | 1656584 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 38 | 445687 | 445929 | - | NZ_CP054021.1 | Rhizobium indicum |
| 39 | 3192890 | 3193114 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 40 | 1387779 | 1388000 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 41 | 1663838 | 1664068 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 42 | 2031377 | 2031604 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 43 | 1111905 | 1112144 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 44 | 2439438 | 2439668 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 45 | 1885432 | 1885683 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 46 | 138047 | 138262 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 47 | 1977346 | 1977567 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 48 | 1701080 | 1701313 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 49 | 4798259 | 4798489 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 50 | 982248 | 982463 | - | NZ_CP071057.1 | Marinicauda algicola |
| 51 | 2260457 | 2260690 | + | NZ_CP004393.1 | Celeribacter indicus |
| 52 | 757553 | 757777 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 53 | 3068800 | 3069042 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 54 | 589573 | 589812 | - | NZ_CP012023.1 | Celeribacter marinus |
| 55 | 2652317 | 2652541 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 56 | 1701090 | 1701311 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 57 | 1802390 | 1802611 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 58 | 1836106 | 1836327 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 59 | 1766881 | 1767102 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 60 | 111209 | 111430 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 61 | 1867373 | 1867594 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 62 | 3624480 | 3624701 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 63 | 1709769 | 1709990 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 64 | 1506772 | 1507011 | + | NZ_CP016364.1 | Phaeobacter porticola |
| 65 | 1946456 | 1946680 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 66 | 1952764 | 1952985 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 67 | 2100147 | 2100368 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 68 | 2458455 | 2458679 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 69 | 1892673 | 1892906 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 70 | 2230441 | 2230662 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 71 | 1024491 | 1024727 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 72 | 1709553 | 1709798 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 73 | 2453111 | 2453317 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 74 | 2556045 | 2556251 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 75 | 958893 | 959117 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 76 | 1919853 | 1920074 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 77 | 1060744 | 1060983 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 78 | 2591398 | 2591655 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 79 | 550024 | 550272 | - | NC_014817.1 | Asticcacaulis excentricus CB 48 |
| 80 | 747080 | 747331 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 81 | 1336948 | 1337175 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 82 | 425914 | 426141 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 83 | 2645782 | 2646009 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 84 | 786678 | 786905 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 85 | 3045043 | 3045261 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 86 | 2894711 | 2894956 | - | NZ_CP043998.1 | Clostridium diolis |
| 87 | 650537 | 650776 | - | NZ_CP027407.1 | Roseobacter denitrificans |
| 88 | 1848076 | 1848315 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 89 | 2198881 | 2199132 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 90 | 2926629 | 2926880 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 91 | 435688 | 435921 | - | NZ_CP020470.1 | Rhodobacter blasticus |
| 92 | 606377 | 606592 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 93 | 2830452 | 2830685 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 94 | 2461681 | 2461908 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 95 | 2746597 | 2746803 | + | NZ_CP026363.1 | Brevibacillus agri |
| 96 | 1288245 | 1288469 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 97 | 2433043 | 2433273 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 98 | 1041691 | 1041927 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 99 | 619965 | 620198 | + | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 100 | 1680421 | 1680630 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 101 | 1343337 | 1343570 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 102 | 2076066 | 2076299 | - | NZ_CP012661.1 | Defluviimonas alba |
| 103 | 819145 | 819378 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 104 | 2609821 | 2610051 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 105 | 1898116 | 1898361 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 106 | 3421391 | 3421624 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 107 | 3816019 | 3816249 | + | NZ_CP021434.1 | Tumebacillus avium |
| 108 | 2606542 | 2606775 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 109 | 2770073 | 2770306 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 110 | 3597674 | 3597895 | - | NZ_CP043404.1 | Bacillus safensis |
| 111 | 2531312 | 2531551 | + | NZ_CP053989.1 | Niallia circulans |
| 112 | 1923095 | 1923346 | - | NZ_CP047045.1 | Terricaulis silvestris |
| 113 | 1987144 | 1987368 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 114 | 4393900 | 4394133 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 115 | 2606979 | 2607212 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 116 | 1789498 | 1789731 | - | NZ_CP020612.1 | Paracoccus contaminans |
| 117 | 2192813 | 2193043 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 118 | 542161 | 542394 | + | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 119 | 3773049 | 3773282 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 120 | 373301 | 373534 | - | NZ_CP034328.1 | Tabrizicola piscis |
| 121 | 34538 | 34768 | + | NZ_CP023671.1 | Clostridium septicum |
| 122 | 1072197 | 1072406 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 123 | 1737675 | 1737902 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 124 | 1787413 | 1787664 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 125 | 3875270 | 3875494 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 126 | 532328 | 532558 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 127 | 3187742 | 3187972 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 128 | 490498 | 490728 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 129 | 977965 | 978225 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 130 | 1549681 | 1549905 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 131 | 1754109 | 1754345 | - | NZ_CP012024.1 | Bacillus smithii |
| 132 | 1995665 | 1995916 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 133 | 2106415 | 2106657 | + | NZ_CP071604.1 | Rhizobium binae |
| 134 | 1548414 | 1548641 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 135 | 1974428 | 1974670 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 136 | 1985835 | 1986077 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 137 | 2615079 | 2615312 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 138 | 2595577 | 2595834 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 139 | 3600366 | 3600581 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 140 | 2119845 | 2120069 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 141 | 66900 | 67130 | - | NC_000918.1 | Aquifex aeolicus VF5 |
| 142 | 2089653 | 2089874 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 143 | 807790 | 808029 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 144 | 1443341 | 1443571 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 145 | 2006902 | 2007123 | + | NZ_CP020906.1 | Rhizobium etli |
| 146 | 3940903 | 3941145 | + | NZ_CP071454.1 | Rhizobium lentis |
| 147 | 2343593 | 2343835 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 148 | 1350865 | 1351089 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 149 | 1763798 | 1764055 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 150 | 1678794 | 1679021 | - | NZ_LR134483.1 | Listeria grayi |
| 151 | 1156090 | 1156302 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 152 | 681154 | 681396 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 153 | 2038748 | 2038969 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 154 | 1957027 | 1957254 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 155 | 1662280 | 1662513 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 156 | 2338277 | 2338501 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 157 | 1402879 | 1403130 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 158 | 1945962 | 1946210 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 159 | 1933064 | 1933309 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 160 | 1913234 | 1913473 | - | NZ_CP048788.1 | Roseobacter ponti |
| 161 | 1806510 | 1806728 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 162 | 3251539 | 3251763 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 163 | 1595402 | 1595623 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 164 | 258340 | 258570 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 165 | 3795632 | 3795856 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 166 | 1205027 | 1205269 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 167 | 1413845 | 1414084 | + | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 168 | 1541678 | 1541917 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 169 | 1890985 | 1891224 | - | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 170 | 1327351 | 1327590 | + | NZ_CP041159.1 | Leisingera aquaemixtae |
| 171 | 2217361 | 2217600 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 172 | 1895793 | 1896032 | - | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 173 | 2558072 | 2558284 | - | NZ_CP034588.1 | Silicimonas algicola |
| 174 | 1391967 | 1392218 | - | NZ_CP054836.1 | Oricola thermophila |
| 175 | 1273904 | 1274125 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 176 | 3335130 | 3335378 | - | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 177 | 1911124 | 1911330 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 178 | 1757109 | 1757321 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 179 | 1678307 | 1678531 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 180 | 2028149 | 2028370 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 181 | 3523189 | 3523419 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 182 | 1653064 | 1653303 | + | NZ_CP058235.1 | Bartonella alsatica |
| 183 | 1489852 | 1490091 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 184 | 1377587 | 1377841 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 185 | 1577150 | 1577371 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 186 | 1718166 | 1718420 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 187 | 1593840 | 1594061 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 188 | 1218708 | 1218917 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 189 | 1680091 | 1680312 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 190 | 1581860 | 1582081 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 191 | 1599739 | 1599981 | + | NZ_CP014204.2 | Clostridium baratii |
| 192 | 3075499 | 3075744 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 193 | 1636810 | 1637031 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 194 | 1056753 | 1056995 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 195 | 1556500 | 1556742 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 196 | 1390430 | 1390663 | + | NZ_CP045073.1 | Paracoccus kondratievae |
| 197 | 75561 | 75794 | - | NZ_CP024422.1 | Paracoccus yeei |
| 198 | 530818 | 531051 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 199 | 2313946 | 2314170 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 200 | 1829222 | 1829443 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 201 | 6632833 | 6633087 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 202 | 1262998 | 1263240 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 203 | 1005686 | 1005919 | + | NZ_LN832559.1 | Paracoccus aminovorans |
| 204 | 1336656 | 1336889 | + | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 205 | 2573333 | 2573545 | + | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 206 | 2295193 | 2295426 | - | NZ_CP019437.1 | Thioclava nitratireducens |
| 207 | 1901334 | 1901558 | - | NZ_CP016538.2 | Planococcus maritimus |
| 208 | 1925205 | 1925429 | - | NZ_CP059540.1 | Planococcus maritimus |
| 209 | 1656365 | 1656589 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 210 | 934758 | 935003 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 211 | 1758584 | 1758823 | + | NZ_CP017940.1 | Phyllobacterium zundukense |
| 212 | 3137478 | 3137687 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 213 | 1309080 | 1309334 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 214 | 1386228 | 1386482 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 215 | 623866 | 624090 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 216 | 2461639 | 2461878 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 217 | 2520193 | 2520432 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 218 | 122986 | 123216 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 219 | 2002633 | 2002875 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 220 | 1454877 | 1455110 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 221 | 2374693 | 2374938 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 222 | 2439437 | 2439676 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 223 | 1086869 | 1087105 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 224 | 1087977 | 1088213 | - | NC_004310.3 | Brucella suis 1330 |
| 225 | 1089984 | 1090220 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 226 | 1093531 | 1093767 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 227 | 900419 | 900655 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 228 | 900532 | 900768 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 229 | 1102489 | 1102725 | - | NC_007618.1 | Brucella abortus 2308 |
| 230 | 1779534 | 1779770 | - | NZ_LT605585.1 | Brucella inopinata |
| 231 | 1184892 | 1185128 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 232 | 1181670 | 1181906 | + | NZ_CP064063.1 | Brucella anthropi |
| 233 | 2052112 | 2052351 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 234 | 2025754 | 2025978 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 235 | 2130075 | 2130299 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 236 | 2065750 | 2065992 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 237 | 2003417 | 2003653 | - | NZ_AP018907.1 | Blastochloris tepida |
| 238 | 2582670 | 2582879 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 239 | 3112186 | 3112434 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 240 | 1676835 | 1677059 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 241 | 1495139 | 1495375 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 242 | 2013971 | 2014180 | - | NZ_CP009687.1 | Clostridium aceticum |
| 243 | 855 | 1109 | + | NZ_CP016616.1 | Microvirga ossetica |
| 244 | 2683228 | 2683458 | - | NZ_CP032509.1 | Georhizobium profundi |
| 245 | 722769 | 723002 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 246 | 1307898 | 1308131 | + | NC_008593.1 | Clostridium novyi NT |
| 247 | 1989425 | 1989658 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 248 | 3148393 | 3148626 | + | NZ_CP030918.1 | Paracoccus suum |
| 249 | 2022787 | 2023026 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 250 | 952376 | 952609 | - | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 251 | 3248481 | 3248720 | - | NZ_CP040818.1 | Paraoceanicella profunda |
| 252 | 1878999 | 1879223 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 253 | 1628620 | 1628856 | - | NZ_CP032125.1 | Profundibacter amoris |
| 254 | 644989 | 645228 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 255 | 4066760 | 4067005 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 256 | 1758034 | 1758279 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 257 | 3117337 | 3117582 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 258 | 4704322 | 4704567 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 259 | 289516 | 289761 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 260 | 6136817 | 6137062 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 261 | 4235733 | 4235978 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 262 | 4138803 | 4139048 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 263 | 4660681 | 4660926 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 264 | 2292260 | 2292505 | + | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 265 | 1518323 | 1518571 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 266 | 1285119 | 1285376 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 267 | 2766525 | 2766773 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 268 | 2296048 | 2296293 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 269 | 2427144 | 2427386 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 270 | 2718321 | 2718557 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 271 | 1147981 | 1148232 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 272 | 1446164 | 1446373 | - | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 273 | 1585320 | 1585589 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014509.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16360.7 | 0.62 | 168 | 69.0 | same-strand | GTP-binding GTPase Middle Region |
| 2 | PF13167.8 | 0.62 | 168 | 69.0 | same-strand | GTP-binding GTPase N-terminal |
| 3 | PF01926.25 | 0.65 | 175 | 78.0 | same-strand | 50S ribosome-binding GTPase |
++ More..