Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L30 |
NCBI Accession ID | AE016823.1 |
Organism | Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) |
Left | 3460824 |
Right | 3461003 |
Strand | - |
Nucleotide Sequence | ATGGAAAACATCATCGTAACCCAAGTAAAAAGTAGCATCGGAGTCAAAAAAGAACACAAGTTAACTCTACATGCTTTAGGCTTAAGAAGAACCGGACAACAGAGAAAGCACAAGGTTTCTCCTCAACTACAAGGAATGTTGAATTCTGTAAGACATCTCATTAAAGTAGAGAAGGCTTAA |
Sequence | MENIIVTQVKSSIGVKKEHKLTLHALGLRRTGQQRKHKVSPQLQGMLNSVRHLIKVEKA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
Pubmed ID | 15028702 |
Domain | CDD:412218 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q72NH9 |
ORF Length (Amino Acid) | 59 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1470406 | 1470585 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
2 | 1612208 | 1612387 | - | NZ_CP033614.1 | Leptospira kmetyi |
3 | 886203 | 886382 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
4 | 3372404 | 3372583 | - | NZ_CP040840.1 | Leptospira weilii |
5 | 1603249 | 1603428 | + | NZ_CP030142.1 | Leptospira mayottensis |
6 | 3354714 | 3354893 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
7 | 2060466 | 2060648 | + | NZ_CP022379.1 | Capnocytophaga sputigena |
8 | 3308328 | 3308510 | - | NZ_CP022022.1 | Capnocytophaga endodontalis |
9 | 2160321 | 2160506 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
10 | 2966411 | 2966584 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
11 | 73291 | 73473 | + | NZ_CP018155.1 | Tenacibaculum todarodis |
12 | 1989587 | 1989769 | + | NZ_CP022387.1 | Capnocytophaga stomatis |
13 | 253657 | 253836 | + | NZ_CP027286.1 | Clostridium chauvoei |
14 | 2018314 | 2018493 | + | NZ_CP023671.1 | Clostridium septicum |
15 | 1307539 | 1307718 | + | NC_014230.1 | Croceibacter atlanticus HTCC2559 |
16 | 2014149 | 2014346 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
17 | 1379489 | 1379671 | + | NC_013162.1 | Capnocytophaga ochracea DSM 7271 |
18 | 415418 | 415600 | - | NZ_CP028136.1 | Gramella fulva |
19 | 1944838 | 1945020 | + | NZ_LT906449.1 | Capnocytophaga haemolytica |
20 | 335282 | 335464 | - | NZ_CP019419.1 | Polaribacter reichenbachii |
21 | 772195 | 772374 | - | NZ_CP011071.1 | Muricauda lutaonensis |
22 | 788067 | 788249 | - | NZ_CP022378.1 | Capnocytophaga cynodegmi |
23 | 1728720 | 1728902 | - | NZ_CP061813.1 | Polaribacter haliotis |
24 | 2007296 | 2007478 | + | NZ_CP020919.1 | Flavobacterium kingsejongi |
25 | 4552878 | 4553036 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
26 | 2810705 | 2810887 | - | NZ_CP014224.1 | Wenyingzhuangia fucanilytica |
27 | 1125678 | 1125851 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
28 | 3802141 | 3802323 | - | NZ_LT899436.1 | Tenacibaculum jejuense |
29 | 497715 | 497894 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
30 | 2472063 | 2472257 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00416.24 | 0.67 | 20 | 2424.5 | same-strand | Ribosomal protein S13/S18 |
2 | PF01176.21 | 0.77 | 23 | 1834 | same-strand | Translation initiation factor 1A / IF-1 |
3 | PF00344.22 | 1.0 | 30 | 477.0 | same-strand | SecY |
4 | PF00828.21 | 1.0 | 30 | 17.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
5 | PF00333.22 | 1.0 | 30 | 12.0 | same-strand | Ribosomal protein S5, N-terminal domain |
6 | PF03719.17 | 1.0 | 30 | 12.0 | same-strand | Ribosomal protein S5, C-terminal domain |
7 | PF00861.24 | 1.0 | 30 | 542.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
8 | PF00347.25 | 1.0 | 30 | 910.0 | same-strand | Ribosomal protein L6 |
9 | PF00410.21 | 1.0 | 30 | 1473.0 | same-strand | Ribosomal protein S8 |
10 | PF00253.23 | 0.8 | 24 | 1944.5 | same-strand | Ribosomal protein S14p/S29e |