Result : Q72KL7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sulfur carrier protein ThiS (Thiamine biosynthesis protein ThiS) |
| NCBI Accession ID | AE017221.1 |
| Organism | Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) |
| Left | 302989 |
| Right | 303183 |
| Strand | + |
| Nucleotide Sequence | ATGGTGTGGCTTAACGGGGAGCCCAGGCCCTTGGAGGGAAAGACCCTCAAGGAGGTCTTGGAGGAAATGGGCGTGGAGCTTAAGGGGGTCGCCGTCCTCCTCAACGAGGAGGCCTTCTTGGGCCTCGAGGTCCCGGACCGCCCCTTGCGGGACGGGGACGTGGTGGAGGTGGTGGCCCTGATGCAGGGGGGTTAG |
| Sequence | MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG |
| Source of smORF | Swiss-Prot |
| Function | Is the sulfur donor in the synthesis of the thiazole phosphate moiety of thiamine phosphate. {ECO:0000305|Pubmed:19037260}. |
| Pubmed ID | 15064768 19037260 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q72KL7 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 640829 | 641023 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 2 | 1331361 | 1331555 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 3 | 498822 | 499016 | + | NZ_CP038452.1 | Thermus caldilimi |
| 4 | 100473 | 100667 | - | NC_019387.1 | Thermus oshimai JL-2 |
| 5 | 765299 | 765493 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 6 | 1649803 | 1649997 | + | NZ_CP016312.1 | Thermus brockianus |
| 7 | 1739394 | 1739588 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 8 | 373228 | 373434 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006461.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13241.8 | 0.62 | 5 | 3434 | opposite-strand | Putative NAD(P)-binding |
| 2 | PF02602.17 | 0.62 | 5 | 2679 | opposite-strand | Uroporphyrinogen-III synthase HemD |
| 3 | PF01077.24 | 0.62 | 5 | 937 | opposite-strand | Nitrite and sulphite reductase 4Fe-4S domain |
| 4 | PF03460.19 | 0.62 | 5 | 937 | opposite-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
| 5 | PF02581.19 | 1.0 | 8 | -13.0 | same-strand | Thiamine monophosphate synthase |
| 6 | PF05690.16 | 0.88 | 7 | 3 | same-strand | Thiazole biosynthesis protein ThiG |
| 7 | PF01266.26 | 0.88 | 7 | 790 | same-strand | FAD dependent oxidoreductase |
| 8 | PF01964.20 | 0.88 | 7 | 1716 | same-strand | Radical SAM ThiC family |
| 9 | PF08543.14 | 0.62 | 5 | 3020 | same-strand | Phosphomethylpyrimidine kinase |
++ More..