Protein Information |
Information Type | Description |
---|---|
Protein name | Sulfur carrier protein ThiS (Thiamine biosynthesis protein ThiS) |
NCBI Accession ID | AE017221.1 |
Organism | Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) |
Left | 302989 |
Right | 303183 |
Strand | + |
Nucleotide Sequence | ATGGTGTGGCTTAACGGGGAGCCCAGGCCCTTGGAGGGAAAGACCCTCAAGGAGGTCTTGGAGGAAATGGGCGTGGAGCTTAAGGGGGTCGCCGTCCTCCTCAACGAGGAGGCCTTCTTGGGCCTCGAGGTCCCGGACCGCCCCTTGCGGGACGGGGACGTGGTGGAGGTGGTGGCCCTGATGCAGGGGGGTTAG |
Sequence | MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG |
Source of smORF | Swiss-Prot |
Function | Is the sulfur donor in the synthesis of the thiazole phosphate moiety of thiamine phosphate. {ECO:0000305|Pubmed:19037260}. |
Pubmed ID | 15064768 19037260 |
Domain | CDD:421700 |
Functional Category | Others |
Uniprot ID | Q72KL7 |
ORF Length (Amino Acid) | 64 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 640829 | 641023 | + | NC_006461.1 | Thermus thermophilus HB8 |
2 | 1331361 | 1331555 | - | NZ_CP014141.1 | Thermus parvatiensis |
3 | 498822 | 499016 | + | NZ_CP038452.1 | Thermus caldilimi |
4 | 100473 | 100667 | - | NC_019387.1 | Thermus oshimai JL-2 |
5 | 765299 | 765493 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
6 | 1649803 | 1649997 | + | NZ_CP016312.1 | Thermus brockianus |
7 | 1739394 | 1739588 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
8 | 373228 | 373434 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13241.8 | 0.62 | 5 | 3434 | opposite-strand | Putative NAD(P)-binding |
2 | PF02602.17 | 0.62 | 5 | 2679 | opposite-strand | Uroporphyrinogen-III synthase HemD |
3 | PF01077.24 | 0.62 | 5 | 937 | opposite-strand | Nitrite and sulphite reductase 4Fe-4S domain |
4 | PF03460.19 | 0.62 | 5 | 937 | opposite-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
5 | PF02581.19 | 1.0 | 8 | -13.0 | same-strand | Thiamine monophosphate synthase |
6 | PF05690.16 | 0.88 | 7 | 3 | same-strand | Thiazole biosynthesis protein ThiG |
7 | PF01266.26 | 0.88 | 7 | 790 | same-strand | FAD dependent oxidoreductase |
8 | PF01964.20 | 0.88 | 7 | 1716 | same-strand | Radical SAM ThiC family |
9 | PF08543.14 | 0.62 | 5 | 3020 | same-strand | Phosphomethylpyrimidine kinase |