Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L29 |
NCBI Accession ID | AE017221.1 |
Organism | Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) |
Left | 1262248 |
Right | 1262466 |
Strand | - |
Nucleotide Sequence | ATGAAGCTCAGTGAGGTGAGGAAGCAGCTGGAGGAGGCCCGGAAGCTCTCCCCCGTGGAGCTGGAGAAGCTCGTGCGGGAGAAGAAGCGGGAGCTCATGGAGCTCCGCTTCCAGGCCTCCATCGGCCAGCTTTCCCAAAACCACAAGATCCGGGACCTCAAGCGCCAGATCGCCAGGCTCCTTACGGTCTTGAACGAGAAGAGGAGGCAAAATGCCTAA |
Sequence | MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
Pubmed ID | 15064768 |
Domain | CDD:415815 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q72I12 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1586378 | 1586596 | - | NC_006461.1 | Thermus thermophilus HB8 |
2 | 413665 | 413883 | + | NZ_CP014141.1 | Thermus parvatiensis |
3 | 262475 | 262693 | + | NC_019386.1 | Thermus oshimai JL-2 |
4 | 323943 | 324161 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
5 | 1335511 | 1335729 | + | NZ_CP016312.1 | Thermus brockianus |
6 | 1561816 | 1562013 | - | NZ_CP038452.1 | Thermus caldilimi |
7 | 1641221 | 1641403 | - | NC_014761.1 | Oceanithermus profundus DSM 14977 |
8 | 2950719 | 2950907 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
9 | 1779308 | 1779514 | - | NZ_CP012805.1 | Streptococcus anginosus |
10 | 1480448 | 1480651 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
11 | 1714949 | 1715155 | - | NZ_CP034543.1 | Streptococcus periodonticum |
12 | 448418 | 448624 | - | NZ_CP032620.1 | Streptococcus koreensis |
13 | 1751769 | 1751975 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
14 | 1971003 | 1971209 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
15 | 295463 | 295669 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
16 | 490398 | 490604 | - | NZ_CP016953.1 | Streptococcus himalayensis |
17 | 1760030 | 1760236 | - | NZ_LS483436.1 | Streptococcus intermedius |
18 | 2034102 | 2034308 | - | NZ_LR594049.1 | Streptococcus gordonii |
19 | 847315 | 847521 | + | NZ_CP015196.1 | Streptococcus marmotae |
20 | 1839314 | 1839520 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
21 | 59537 | 59743 | + | NZ_LR594050.1 | Streptococcus porcinus |
22 | 1169382 | 1169588 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
23 | 1857491 | 1857697 | - | NZ_LR134275.1 | Streptococcus vestibularis |
24 | 73738 | 73944 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
25 | 504246 | 504452 | - | NZ_LR134293.1 | Streptococcus canis |
26 | 74459 | 74665 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
27 | 493436 | 493642 | + | NZ_CP022680.1 | Streptococcus respiraculi |
28 | 1832749 | 1832955 | - | NZ_LT906439.1 | Streptococcus merionis |
29 | 2164293 | 2164496 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
30 | 169382 | 169573 | + | NZ_AP019827.1 | Leptotrichia shahii |
31 | 129794 | 129985 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
32 | 2130241 | 2130432 | - | NZ_AP019829.2 | Leptotrichia wadei |
33 | 248047 | 248238 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
34 | 2521376 | 2521567 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
35 | 812672 | 812866 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00253.23 | 0.89 | 31 | 1646 | same-strand | Ribosomal protein S14p/S29e |
2 | PF00673.23 | 0.97 | 34 | 1087.0 | same-strand | ribosomal L5P family C-terminus |
3 | PF00281.21 | 0.97 | 34 | 1087.0 | same-strand | Ribosomal protein L5 |
4 | PF17136.6 | 1.0 | 35 | 755 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
5 | PF00467.31 | 0.86 | 30 | 756.0 | same-strand | KOW motif |
6 | PF00238.21 | 1.0 | 35 | 311 | same-strand | Ribosomal protein L14p/L23e |
7 | PF00366.22 | 1.0 | 35 | 24 | same-strand | Ribosomal protein S17 |
8 | PF00252.20 | 1.0 | 35 | 10 | same-strand | Ribosomal protein L16p/L10e |
9 | PF00189.22 | 1.0 | 35 | 427 | same-strand | Ribosomal protein S3, C-terminal domain |
10 | PF07650.19 | 1.0 | 35 | 427 | same-strand | KH domain |
11 | PF00237.21 | 1.0 | 35 | 1093 | same-strand | Ribosomal protein L22p/L17e |
12 | PF00203.23 | 1.0 | 35 | 1453 | same-strand | Ribosomal protein S19 |
13 | PF03947.20 | 1.0 | 35 | 1832 | same-strand | Ribosomal Proteins L2, C-terminal domain |
14 | PF00181.25 | 1.0 | 35 | 1832 | same-strand | Ribosomal Proteins L2, RNA binding domain |