Result : Q72G84
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | AE017221.1 |
| Organism | Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) |
| Left | 1868550 |
| Right | 1868846 |
| Strand | + |
| Nucleotide Sequence | ATGTCCAAGGTGTGCGAGATCAGCGGAAAGCGGCCCATCGTGGCCAACAGCATCCAAAGGCGGGGTAAGGCCAAGCGGGAAGGGGGTGTGGGCAAGAAGACCACCGGCATCTCCAAGCGCCGCCAGTACCCCAACCTGCAGAAGGTCCGGGTGCGGGTCGCCGGCCAGGAGATCACCTTCCGCGTGGCCGCAAGCCACATCCCCAAGGTCTACGAGCTCGTGGAGCGGGCCAAGGGGCTTAGGCTGGAGGGGCTTTCCCCTAAGGAGATCAAGAAGGAGCTCCTCAAGCTCCTCTAG |
| Sequence | MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELLKLL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15064768 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q72G84 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 43369 | 43665 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 2 | 1662015 | 1662311 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 3 | 192670 | 192966 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 4 | 898423 | 898719 | - | NZ_CP016312.1 | Thermus brockianus |
| 5 | 1758033 | 1758329 | - | NZ_CP038452.1 | Thermus caldilimi |
| 6 | 2109532 | 2109828 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 7 | 31901 | 32200 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 8 | 3060834 | 3061130 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 9 | 2165568 | 2165870 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019386.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01252.20 | 1.0 | 9 | 74 | opposite-strand | Signal peptidase (SPase) II |
| 2 | PF00155.23 | 0.78 | 7 | 624 | same-strand | Aminotransferase class I and II |
| 3 | PF01551.24 | 0.78 | 7 | 66 | same-strand | Peptidase family M23 |
| 4 | PF01594.18 | 0.78 | 7 | 781 | same-strand | AI-2E family transporter |
++ More..