Protein Information |
Information Type | Description |
---|---|
Protein name | Flagellar hook-basal body complex protein FliE |
NCBI Accession ID | AE017262.2 |
Organism | Listeria monocytogenes serotype 4b (strain F2365) |
Left | 757910 |
Right | 758206 |
Strand | + |
Nucleotide Sequence | ATGGCAATTGAAAGTATTAATGCAGCAAGTGTCTTACCTAAAGTAACGCTTGGTGAAACCGCGAAAACAGACAATGCGACAGGTGCCGGAAATACCTTCACGCAAATGCTGGATAGTATGAGTGATACACAATCAAACGCGCAAACTTCCGTATCGAACCTTTTAACAACAGGCGAAGGAAATGCGAGTGATGTACTCATTCAAATGAAAAAAGCAGAATCAGAAATGAAAACTGCTGCGGTCATTCGTGATAATGTAATCGAAAGCTACAAACAGCTTTTAAATATGCAAGTGTAG |
Sequence | MAIESINAASVLPKVTLGETAKTDNATGAGNTFTQMLDSMSDTQSNAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09139. Profile Description: Flagellar hook-basal body complex protein FliE. fliE is a component of the flagellar hook-basal body complex located possibly at (MS-ring)-rod junction. [Cellular processes, Chemotaxis and motility] |
Pubmed ID | 15115801 |
Domain | CDD:415593 |
Functional Category | Others |
Uniprot ID | Q722I5 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 743418 | 743714 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
2 | 743313 | 743609 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
3 | 707287 | 707583 | + | NZ_LT906444.1 | Listeria welshimeri |
4 | 652145 | 652441 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
5 | 2035701 | 2035997 | - | NZ_LR134483.1 | Listeria grayi |
6 | 1451028 | 1451312 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
7 | 1571533 | 1571817 | + | NZ_CP064875.1 | Bacillus toyonensis |
8 | 3516845 | 3517129 | - | NZ_CP040336.1 | Bacillus luti |
9 | 1628676 | 1628960 | + | NC_011725.1 | Bacillus cereus B4264 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07195.14 | 1.0 | 9 | 1520 | same-strand | Flagellar hook-associated protein 2 C-terminus |
2 | PF02465.20 | 1.0 | 9 | 1520 | same-strand | Flagellar hook-associated protein 2 N-terminus |
3 | PF02561.16 | 1.0 | 9 | 1114 | same-strand | Flagellar protein FliS |
4 | PF00460.22 | 1.0 | 9 | 17 | same-strand | Flagella basal body rod protein |
5 | PF01514.19 | 1.0 | 9 | 62 | same-strand | Secretory protein of YscJ/FliF family |
6 | PF08345.13 | 1.0 | 9 | 62 | same-strand | Flagellar M-ring protein C-terminal |
7 | PF01706.18 | 1.0 | 9 | 1715 | same-strand | FliG C-terminal domain |
8 | PF14841.8 | 1.0 | 9 | 1715 | same-strand | FliG middle domain |
9 | PF14842.8 | 0.89 | 8 | 1715.0 | same-strand | FliG N-terminal domain |
10 | PF02108.18 | 0.89 | 8 | 2708.0 | same-strand | Flagellar assembly protein FliH |
11 | PF00006.27 | 1.0 | 9 | 3503 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
12 | PF18269.3 | 1.0 | 9 | 3503 | same-strand | T3SS EscN ATPase C-terminal domain |