Result : Q71ZG9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein LMOf2365_1520 |
| NCBI Accession ID | AE017262.2 |
| Organism | Listeria monocytogenes serotype 4b (strain F2365) |
| Left | 1511108 |
| Right | 1511410 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGAAGAACATAACCATAATCATGAAGAAGAAAATATTATTTGGATCACAAACGAAGAAGGAAAAGAAGAAGCTTACGAAATTCTTTTTGATTTTGATTCCGAAGACTTTGACAAATCTTATGTTTTATATTTCCCAGCTGGCAAAGGGGAAGACGAAGAAATCGAAATCCTTGCATCTAGCTATATCCAAGATGAAGAAGGCAAACAAGGTCAACTTAAACCAGTTGAAACAGATGAAGAATGGGATATGATTGAAGAAATCCTTGCAACATTCTTAGCTGACGAAGACGAAGAATAA |
| Sequence | MAEEHNHNHEEENIIWITNEEGKEEAYEILFDFDSEDFDKSYVLYFPAGKGEDEEIEILASSYIQDEEGKQGQLKPVETDEEWDMIEEILATFLADEDEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | 15115801 |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | Q71ZG9 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 70
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1531398 | 1531700 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 2 | 1508509 | 1508811 | - | NZ_LT906444.1 | Listeria welshimeri |
| 3 | 1443999 | 1444301 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 4 | 1565502 | 1565804 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 5 | 1455645 | 1455914 | - | NZ_LR134483.1 | Listeria grayi |
| 6 | 1839910 | 1840218 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 7 | 1913371 | 1913664 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 8 | 2629808 | 2630089 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 9 | 2680725 | 2681006 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 10 | 1094440 | 1094739 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 11 | 2607671 | 2607952 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 12 | 2797100 | 2797381 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 13 | 2615390 | 2615671 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 14 | 1321966 | 1322265 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 15 | 2755135 | 2755419 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 499833 | 500147 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 17 | 1953577 | 1953885 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 18 | 2533361 | 2533642 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 19 | 3500247 | 3500528 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 20 | 2397988 | 2398308 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 21 | 1265879 | 1266196 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 22 | 3089884 | 3090168 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 23 | 3578999 | 3579286 | - | NZ_CP053989.1 | Niallia circulans |
| 24 | 3418854 | 3419135 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 25 | 2885881 | 2886162 | + | NZ_CP043404.1 | Bacillus safensis |
| 26 | 1637176 | 1637466 | + | NZ_LS483476.1 | Lederbergia lentus |
| 27 | 736328 | 736648 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 28 | 2945838 | 2946122 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 29 | 1344626 | 1344907 | + | NZ_CP011937.1 | Bacillus velezensis |
| 30 | 2643130 | 2643411 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 31 | 2971923 | 2972201 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 32 | 4362033 | 4362317 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 33 | 2322315 | 2322560 | - | NZ_CP012024.1 | Bacillus smithii |
| 34 | 2418581 | 2418865 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 35 | 2096514 | 2096795 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 36 | 2682455 | 2682748 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 37 | 1457953 | 1458282 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 38 | 3177972 | 3178262 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 39 | 3459469 | 3459756 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 40 | 1567108 | 1567395 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 41 | 1526508 | 1526819 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 42 | 818775 | 819029 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 43 | 89348 | 89659 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 44 | 106456 | 106707 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 45 | 1353865 | 1354146 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 46 | 125540 | 125845 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 47 | 3311646 | 3311939 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 48 | 3999990 | 4000283 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 49 | 3849119 | 3849397 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 50 | 1909086 | 1909412 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 51 | 2018625 | 2018918 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 52 | 1116797 | 1117111 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 53 | 2566060 | 2566359 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 54 | 3369267 | 3369566 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 55 | 4377444 | 4377734 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 56 | 1442118 | 1442363 | + | NZ_CP016538.2 | Planococcus maritimus |
| 57 | 1451525 | 1451770 | + | NZ_CP059540.1 | Planococcus maritimus |
| 58 | 1194946 | 1195191 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 59 | 3416161 | 3416448 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 60 | 782837 | 783127 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 61 | 1445398 | 1445676 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 62 | 1448149 | 1448460 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 63 | 1393356 | 1393667 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 64 | 1415252 | 1415560 | + | NZ_CP016540.2 | Planococcus versutus |
| 65 | 1477883 | 1478125 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 66 | 2569780 | 2570085 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 67 | 1336226 | 1336534 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 68 | 2576275 | 2576529 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 69 | 294182 | 294490 | - | NZ_CP013661.2 | Planococcus kocurii |
| 70 | 1488616 | 1488924 | + | NZ_CP019401.1 | Planococcus faecalis |
| 71 | 1566724 | 1567032 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003210.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00485.20 | 0.74 | 52 | 4133 | same-strand | Phosphoribulokinase / Uridine kinase family |
| 2 | PF13238.8 | 0.74 | 52 | 4133 | same-strand | AAA domain |
| 3 | PF01596.19 | 0.76 | 53 | 1552.0 | same-strand | O-methyltransferase |
| 4 | PF13578.8 | 0.76 | 53 | 1552.0 | same-strand | Methyltransferase domain |
| 5 | PF02618.18 | 0.86 | 60 | 200 | same-strand | YceG-like family |
| 6 | PF03652.17 | 1.0 | 70 | 16 | same-strand | Holliday junction resolvase |
| 7 | PF06135.14 | 1.0 | 70 | 437 | same-strand | IreB regulatory phosphoprotein |
| 8 | PF01411.21 | 0.94 | 66 | 793 | same-strand | tRNA synthetases class II (A) |
| 9 | PF02272.21 | 0.94 | 66 | 793 | same-strand | DHHA1 domain |
| 10 | PF07973.16 | 0.94 | 66 | 793 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..