Result : Q71XK8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0337 protein LMOf2365_2190 |
| NCBI Accession ID | AE017262.2 |
| Organism | Listeria monocytogenes serotype 4b (strain F2365) |
| Left | 2232059 |
| Right | 2232244 |
| Strand | - |
| Nucleotide Sequence | ATGAGCGAAGATAAAGGCATGAAAGACAAAGCAAAAGGACTTAAAGACAAAGTAGTAGGTGACGCAAAAGACAAGTTCGGTAAAGCAACAGATGATAAAGGCAAACAAGTAGAAGGTAAAGCTCAAAAAGCTAAAGGCGAAGTAGAAGATAAAACTGGCGACGCTAAAAAGAAATTATCCGAATAA |
| Sequence | MSEDKGMKDKAKGLKDKVVGDAKDKFGKATDDKGKQVEGKAQKAKGEVEDKTGDAKKKLSE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
| Pubmed ID | 15115801 |
| Domain | CDD:419889 |
| Functional Category | Others |
| Uniprot ID | Q71XK8 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2313217 | 2313402 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 2 | 2242097 | 2242282 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 3 | 2199283 | 2199468 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 4 | 2207744 | 2207929 | - | NZ_LT906444.1 | Listeria welshimeri |
| 5 | 2139334 | 2139528 | - | NZ_LR134483.1 | Listeria grayi |
| 6 | 748811 | 748975 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 7 | 970585 | 970770 | - | NZ_CP043404.1 | Bacillus safensis |
| 8 | 1061742 | 1061927 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 9 | 1266230 | 1266406 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 10 | 720397 | 720597 | + | NZ_LS483476.1 | Lederbergia lentus |
| 11 | 2452259 | 2452444 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 12 | 2361883 | 2362068 | + | NZ_CP016540.2 | Planococcus versutus |
| 13 | 2759274 | 2759459 | - | NZ_CP013661.2 | Planococcus kocurii |
| 14 | 2503057 | 2503242 | + | NZ_CP019401.1 | Planococcus faecalis |
| 15 | 2702448 | 2702657 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 16 | 2345270 | 2345455 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 17 | 265410 | 265595 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 18 | 1795032 | 1795220 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 19 | 4949347 | 4949526 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 20 | 988140 | 988322 | - | NZ_CP024422.1 | Paracoccus yeei |
| 21 | 1720429 | 1720608 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 22 | 17664 | 17855 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 23 | 36662 | 36823 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 24 | 32066 | 32227 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 25 | 1339081 | 1339275 | - | NZ_CP029684.2 | Oenococcus sicerae |
| 26 | 33485 | 33646 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 27 | 2756123 | 2756287 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 28 | 3463798 | 3463974 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 29 | 1188332 | 1188514 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 30 | 3602826 | 3602987 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 31 | 2721991 | 2722161 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 32 | 3597351 | 3597512 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..