| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 3 (EC 3.1.-.-) |
| NCBI Accession ID | AP004311.1 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | 89620 |
| Right | 89898 |
| Strand | + |
| Nucleotide Sequence | ATGTTTCTCTATGTTATTGCCTACGATATTCCTGATGATCGCCGTCGTAAAAAGATGGCCGATTTATTAGAAGGTTATGGCCAAAGGGTGCAATATTCTGTATTTGAATGTACATTGTCTAAGTCTAAGTTTAATGAATTGCAAAAACGTCTCCGCAAAATTTATCAATCAGAGGAAGATAGTTTGCGTTTTTATCCTTTGTCTGGGCATACCCTCACCCAGGTTGATATTTGGGGGGAACCACCACTCACTAAGCCCCCTGGCTCAGTCATTGTCTAA |
| Sequence | MFLYVIAYDIPDDRRRKKMADLLEGYGQRVQYSVFECTLSKSKFNELQKRLRKIYQSEEDSLRFYPLSGHTLTQVDIWGEPPLTKPPGSVIV |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
| Pubmed ID | 14686584 |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | Q6ZEA5 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2419274 | 2419552 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 2 | 2294248 | 2294526 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 3 | 499628 | 499879 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 4 | 38770 | 39048 | + | NZ_CP042327.1 | Euhalothece natronophila Z-M001 |
| 5 | 489191 | 489469 | - | NC_014533.1 | Gloeothece verrucosa PCC 7822 |
| 6 | 1792547 | 1792828 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 7 | 40608 | 40889 | + | NC_019777.1 | Cyanobacterium aponinum PCC 10605 |
| 8 | 26010 | 26291 | - | NC_019773.1 | Anabaena cylindrica PCC 7122 |
| 9 | 451319 | 451597 | + | NZ_AP014640.1 | Leptolyngbya boryana IAM M-101 |
| 10 | 534062 | 534343 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 11 | 2543682 | 2543963 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 12 | 4194303 | 4194584 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01867.18 | 0.91 | 10 | 11 | same-strand | CRISPR associated protein Cas1 |