Result : Q6YPI4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | AP006628.2 |
| Organism | Onion yellows phytoplasma (strain OY-M) |
| Left | 838388 |
| Right | 838594 |
| Strand | - |
| Nucleotide Sequence | ATGATTAAAGTGATTAAGAAAAAATCCCACAGCGGGCTTAAAAAACGAATTAAAATTTCTAAAAAGAAAAAATTATTAAGAGGCCACGCCTACAAAAATCACCTTGCAGCTTCCAAAACTACTAAACAAAACCGCCAACTAAGAGGAGTTACTTGTGTTAAACTTTGTGATTACAACAGAATCAAAACTCTTATTAGAGGATTATAG |
| Sequence | MIKVIKKKSHSGLKKRIKISKKKKLLRGHAYKNHLAASKTTKQNRQLRGVTCVKLCDYNRIKTLIRGL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 14661021 |
| Domain | |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6YPI4 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 849573 | 849770 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 952618 | 952818 | + | NC_022549.1 | Acholeplasma brassicae |
| 3 | 1323141 | 1323341 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 4 | 875382 | 875582 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 5 | 561504 | 561704 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 6 | 224802 | 224996 | - | NZ_CP024161.1 | Mycoplasma dispar |
| 7 | 180836 | 181015 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 8 | 421127 | 421315 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 9 | 475919 | 476107 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 10 | 202056 | 202244 | + | NZ_AP014631.1 | Mycoplasma canadense |
| 11 | 341019 | 341198 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 12 | 512528 | 512722 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 13 | 577192 | 577380 | - | NZ_LS991949.1 | Mycoplasma alkalescens |
| 14 | 293616 | 293804 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 15 | 2742904 | 2743083 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 16 | 2036859 | 2037053 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 17 | 2273724 | 2273918 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 18 | 4253135 | 4253329 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022538.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 1.0 | 18 | 15.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF05198.18 | 0.78 | 14 | 11.5 | same-strand | Translation initiation factor IF-3, N-terminal domain |
++ More..