Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L35 |
NCBI Accession ID | AP006628.2 |
Organism | Onion yellows phytoplasma (strain OY-M) |
Left | 838388 |
Right | 838594 |
Strand | - |
Nucleotide Sequence | ATGATTAAAGTGATTAAGAAAAAATCCCACAGCGGGCTTAAAAAACGAATTAAAATTTCTAAAAAGAAAAAATTATTAAGAGGCCACGCCTACAAAAATCACCTTGCAGCTTCCAAAACTACTAAACAAAACCGCCAACTAAGAGGAGTTACTTGTGTTAAACTTTGTGATTACAACAGAATCAAAACTCTTATTAGAGGATTATAG |
Sequence | MIKVIKKKSHSGLKKRIKISKKKKLLRGHAYKNHLAASKTTKQNRQLRGVTCVKLCDYNRIKTLIRGL |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 14661021 |
Domain | |
Functional Category | Ribosomal_protein |
Uniprot ID | Q6YPI4 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 849573 | 849770 | + | NC_022538.1 | Acholeplasma palmae J233 |
2 | 952618 | 952818 | + | NC_022549.1 | Acholeplasma brassicae |
3 | 1323141 | 1323341 | - | NZ_LR215048.1 | Acholeplasma axanthum |
4 | 875382 | 875582 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
5 | 561504 | 561704 | - | NZ_LR215050.1 | Acholeplasma hippikon |
6 | 224802 | 224996 | - | NZ_CP024161.1 | Mycoplasma dispar |
7 | 180836 | 181015 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
8 | 421127 | 421315 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
9 | 475919 | 476107 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
10 | 202056 | 202244 | + | NZ_AP014631.1 | Mycoplasma canadense |
11 | 341019 | 341198 | + | NZ_CP030103.1 | Mycoplasma cloacale |
12 | 512528 | 512722 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
13 | 577192 | 577380 | - | NZ_LS991949.1 | Mycoplasma alkalescens |
14 | 293616 | 293804 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
15 | 2742904 | 2743083 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
16 | 2036859 | 2037053 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
17 | 2273724 | 2273918 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
18 | 4253135 | 4253329 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00707.24 | 1.0 | 18 | 15.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
2 | PF05198.18 | 0.78 | 14 | 11.5 | same-strand | Translation initiation factor IF-3, N-terminal domain |