Result : Q6NJ54
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESAT-6-like protein EsxA |
| NCBI Accession ID | BX248355.1 |
| Organism | Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) |
| Left | 182132 |
| Right | 182419 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAGATTAAATATGGCTTTGGTGAAATCGAAGCAGCCGCATCGGACATCCAATCCACGTCCGGTCGTATCAACTCCCTGCTAGAAGATCTCAAAGCGCACATCCGGCCCATGGCTGCAGCATGGGAAGGCGAATCAGCGCAAGCCTATAACGAGGCACAACAGCAGTGGGACAGCTCCGCTGCGGAACTCAACACCATCTTGTCTACGATTTCCAACACTGTTCGTCAGGGCAATGATCGCATGAGTGAGGTGAACCGTATGGCCGCTGCTTCGTGGAGCTAA |
| Sequence | MEKIKYGFGEIEAAASDIQSTSGRINSLLEDLKAHIRPMAAAWEGESAQAYNEAQQQWDSSAAELNTILSTISNTVRQGNDRMSEVNRMAAASWS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313; |
| Pubmed ID | 14602910 19854905 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | Q6NJ54 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 478361 | 478648 | + | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 2 | 536446 | 536733 | + | NZ_LR738855.1 | Corynebacterium rouxii |
| 3 | 409926 | 410213 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 4 | 522745 | 523032 | + | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 5 | 556027 | 556314 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 6 | 458470 | 458712 | + | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 7 | 1941624 | 1941911 | - | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 8 | 1953243 | 1953530 | - | NZ_CP035299.1 | Corynebacterium pelargi |
| 9 | 418243 | 418530 | + | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 10 | 1863788 | 1864075 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 11 | 1958330 | 1958611 | + | NZ_LT906443.1 | Corynebacterium ulcerans |
| 12 | 471489 | 471779 | + | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
| 13 | 419094 | 419375 | + | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 14 | 559625 | 559912 | + | NZ_LR698967.1 | Corynebacterium ammoniagenes |
| 15 | 525578 | 525865 | + | NZ_CP009251.1 | Corynebacterium stationis |
| 16 | 1328216 | 1328503 | + | NZ_LS483464.1 | Corynebacterium renale |
| 17 | 772070 | 772360 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 18 | 577263 | 577553 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 19 | 619630 | 619920 | + | NZ_CP015622.1 | Corynebacterium crudilactis |
| 20 | 620747 | 621037 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 21 | 605866 | 606156 | + | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 22 | 2215155 | 2215442 | - | NZ_CP067012.1 | Corynebacterium kefirresidentii |
| 23 | 473577 | 473864 | + | NZ_CP011545.1 | Corynebacterium testudinoris |
| 24 | 606043 | 606330 | + | NC_020302.1 | Corynebacterium halotolerans YIM 70093 = DSM 44683 |
| 25 | 740338 | 740625 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 26 | 475125 | 475412 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 27 | 1697385 | 1697675 | - | NC_022198.1 | Corynebacterium argentoratense DSM 44202 |
| 28 | 399390 | 399677 | + | NZ_CP011311.1 | Corynebacterium camporealensis |
| 29 | 1622574 | 1622864 | - | NZ_CP032788.1 | Corynebacterium xerosis |
| 30 | 1081707 | 1081994 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 31 | 594520 | 594807 | + | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 32 | 513909 | 514196 | + | NZ_CP010827.1 | Corynebacterium singulare |
| 33 | 2163343 | 2163630 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 34 | 508016 | 508303 | + | NZ_CP009246.1 | Corynebacterium flavescens |
| 35 | 468384 | 468671 | + | NZ_CP039247.1 | Corynebacterium endometrii |
| 36 | 2263010 | 2263297 | - | NZ_LS483460.1 | Corynebacterium minutissimum |
| 37 | 1666617 | 1666853 | - | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 38 | 511191 | 511478 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 39 | 2250097 | 2250384 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 40 | 529064 | 529354 | + | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 41 | 402578 | 402868 | + | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 42 | 2143654 | 2143914 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
| 43 | 488357 | 488644 | + | NC_012590.1 | Corynebacterium aurimucosum ATCC 700975 |
| 44 | 411252 | 411539 | + | NZ_CP011546.1 | Corynebacterium uterequi |
| 45 | 688431 | 688712 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 46 | 2185670 | 2185951 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 47 | 1840402 | 1840683 | - | NZ_CP046883.1 | Corynebacterium anserum |
| 48 | 445366 | 445653 | + | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 49 | 857291 | 857572 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 50 | 2347601 | 2347882 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 51 | 2057610 | 2057891 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 52 | 581961 | 582248 | + | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 53 | 531564 | 531848 | + | NZ_LT906467.1 | Corynebacterium imitans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP004353.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01580.20 | 0.6 | 32 | 1619.0 | same-strand | FtsK/SpoIIIE family |
| 2 | PF06013.14 | 0.96 | 51 | 51 | same-strand | Proteins of 100 residues with WXG |
| 3 | PF10824.10 | 0.7 | 37 | 51 | same-strand | Excreted virulence factor EspC, type VII ESX diderm |
| 4 | PF00572.20 | 1.0 | 53 | 382 | same-strand | Ribosomal protein L13 |
| 5 | PF00380.21 | 0.96 | 51 | 827 | same-strand | Ribosomal protein S9/S16 |
| 6 | PF02878.18 | 0.72 | 38 | 1905.5 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 7 | PF02880.18 | 0.72 | 38 | 1905.5 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 8 | PF02879.18 | 0.72 | 38 | 1905.5 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
| 9 | PF00408.22 | 0.72 | 38 | 1905.5 | same-strand | Phosphoglucomutase/phosphomannomutase, C-terminal domain |
| 10 | PF00082.24 | 0.64 | 34 | 6923.0 | opposite-strand | Subtilase family |
++ More..