Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | BX248357.1 |
Organism | Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) |
Left | 207922 |
Right | 208188 |
Strand | - |
Nucleotide Sequence | ATGAACCTAGGACCTACCGAAATCCTGTTAATCCTCGTCATCGTTGTACTGCTTTTTGGCGCCAAAAAGCTCCCCGATGCAGCGCGTTCTCTTGGCCGCTCTATGCGCATTTTTAAGTCTGAAGTAAAAGAAATGAGCAATGACGATCAACGCTATGAGGAGCAACAGCAGCAGCGTCAGATCGCAGCACAGGCTCAGCAGCAAGTCGTCAATCCTGTAGAGATTCCACAGCCACAGCCAACTGATATTCAGCGTCCACAGCAATAA |
Sequence | MNLGPTEILLILVIVVLLFGAKKLPDAARSLGRSMRIFKSEVKEMSNDDQRYEEQQQQRQIAAQAQQQVVNPVEIPQPQPTDIQRPQQ |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 14602910 |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | Q6NH98 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1213189 | 1213455 | - | NZ_LR738855.1 | Corynebacterium rouxii |
2 | 1228409 | 1228675 | - | NZ_LN831026.1 | Corynebacterium diphtheriae |
3 | 1093010 | 1093258 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
4 | 1464095 | 1464331 | - | NZ_CP033896.1 | Corynebacterium choanae |
5 | 1396589 | 1396852 | + | NZ_CP067012.1 | Corynebacterium kefirresidentii |
6 | 2811739 | 2811987 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
7 | 1126793 | 1127008 | + | NZ_CP008944.1 | Corynebacterium atypicum |
8 | 3595504 | 3595719 | + | NZ_AP023396.1 | Nocardia wallacei |
9 | 1067969 | 1068244 | - | NZ_CP032229.1 | Streptomyces seoulensis |
10 | 1078907 | 1079182 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
11 | 2338240 | 2338482 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
12 | 2637327 | 2637569 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
13 | 1457703 | 1457966 | + | NZ_CP010827.1 | Corynebacterium singulare |
14 | 1939604 | 1939861 | + | NZ_CP038157.1 | Corynebacterium sanguinis |
15 | 6423536 | 6423814 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
16 | 1750970 | 1751248 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
17 | 1789379 | 1789678 | - | NZ_CP059991.1 | Streptomyces gardneri |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00557.26 | 0.65 | 11 | 4665 | same-strand | Metallopeptidase family M24 |
2 | PF08148.14 | 1.0 | 17 | 1143.5 | same-strand | DSHCT (NUC185) domain |
3 | PF00270.31 | 1.0 | 17 | 1137 | same-strand | DEAD/DEAH box helicase |
4 | PF04851.17 | 1.0 | 17 | 1137 | same-strand | Type III restriction enzyme, res subunit |
5 | PF00902.20 | 1.0 | 17 | 73 | same-strand | Sec-independent protein translocase protein (TatC) |
6 | PF19187.2 | 1.0 | 17 | 98 | same-strand | PafC helix-turn-helix domain |
7 | PF13280.8 | 1.0 | 17 | 989.0 | same-strand | WYL domain |
8 | PF03136.17 | 0.76 | 13 | 2798 | same-strand | Pup-ligase protein |